BLAST

Last updated on 2025-10-21 | Edit this page

Overview

Questions

  • How to use the command-line version of BLAST?

Objectives

  • Run different flavors of BLAST
  • Use different databases
  • Use profile-based BLAST to retrieve distant homologs

Introduction


The goal of this exercise is to practice with the command line-based version of BLAST. It is also the first step in building phylogenetic trees, namely by gathering homologous sequences that will then be aligned. The alignment is finally used to build a tree.

The whole exercise is based on RpoB, the β-subunit of the bacterial RNA polymerase. This protein is essential to the cell, and present in all bacteria and plastids. It is also very conserved, and thus suitable for deep-scale phylogenies.

BLAST

BLAST (basic local alignment search tool, also referred to as the Google of biological research) is one of the most widely used tools in bioinformatics. The wide majority of its uses can be performed online, but for larger searches, batches or advanced uses, the command line version, performed locally on a computer or cluster, is indispensable.

Resources at UPPMAX

BLAST is available at UPPMAX. To load the blast module, you will need to load the bioinfo-tools module first. The blast module also loads the blast_databases module, to be able to use the standard databases that NCBI maintains.

BASH

module load bioinfo-tools blast

Databases available at UPPMAX are described here: https://docs.uppmax.uu.se/databases/blast/. The blast_databases module implies that you don’t need to specify where the databases are located on the file system. In detail, it sets the BLASTDB variable to the right folder. You can see it by typing echo $BLASTDB in the terminal.

Gene and protein records are usually associated with a taxid, to describe what organisms they come from. This can be very useful to limit the search to a certain taxon, or to exclude another taxon. E.g. if you want to investigate whether a certain gene has been transferred from bacteria to archaea: you would search for that specific by excluding all bacteria and eukaryotes.

Taxonomy resources at UPPMAX are described here: https://docs.uppmax.uu.se/databases/ncbi/

Exercise 0: Login to Uppmax


This is just a reminder of the introduction to Linux and how to login to Uppmax.

Challenge

Challenge 0.1

Login to Uppmax and navigate to the course folder, create a folder for a blast exercise.

Remember the best practices you learned for file naming.

All exercises should be performed inside /proj/g2020004/nobackup/3MK013/<username> where <username> is your own folder.

ssh is used to connect to an external server. -Y forwards the graphical display to your computer. The address of the server is rackham.uppmax.uu.se. You need to add your user name in front of it, with a @ in between.

The course folder is at /proj/g2020004/nobackup/3MK013/.

There, make a folder with your username.

Inside it, create a blast folder for this exercise.

Challenge

Challenge 0.2

Access an interactive session that is booked for us. The session is uppmax2025-3-4. Use the snowy cluster, for 4 hours.

BASH

interactive -A <project> -M <cluster> -t <hh:mm:ss> 

Exercise 1: Finding and retrieving homologs


Here, you will first find the protein query to start your search with. You will test different methods to create a file containing only RpoB from E. coli. Then, you will use that file as a query to find homologs of RpoB in different databases.

Task 1.1: Retrieve the RpoB sequence for E. coli

First, use your recently acquired NCBI-fu to retrieve the sequence from E. coli K-12. There are many genomes, and thus many identical proteins, grouped into Identical Protein Groups. NCBI’s databases are (almost) non-redundant (that’s where the name of the largest protein database, nr comes from), and thus only one representative per IPG is present. Thus search in IPG, and find the IPG’s accession number. Write down the accession number somewhere.

Challenge

Challenge 1.1.1: Finding E. coli’s RpoB

Find the accession number for the IPG containing the RpoB sequence of E. coli K-12, and download the sequence in FASTA format.

The accession number is WP_000263098.1.

The sequence in fasta format can be downloaded at https://www.ncbi.nlm.nih.gov/protein/ by searching the accession number clicking on the “Send to” link and then choosing FASTA format. Save the file under rpoB_ecoli.fasta.

The fasta file should look like:

>WP_000263098.1 MULTISPECIES: DNA-directed RNA polymerase subunit beta [Enterobacteriaceae]
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQY
VSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVING

Task 1.2: Push the sequence to UPPMAX

The sequence is located on your computer, and you need to transfer it to your computer. You will test several methods to push it to UPPMAX, to be able to use it as a query for BLAST.

Challenge

Challenge 1.2.1: Use scp

scp, secure file copy, is a tool to copy files via SSH, the same protocol you use to login to UPPMAX. You can use it on your computer with the following syntax:

BASH

scp <file to copy> <username>@<server>:<remote file location>

The remote file location can be a relative path from your home or an absolute path, starting with /.

To bring up a local terminal on your Windows computer, click on the “+” sign on the main window of MobaXTerm. If that doesn’t work, use SFTP. Click on Session, SFTP, and fill in the Remote host as usual rackham.uppmax.uu.se and your username. Navigate to /proj/g2020004/nobackup/3MK013/<username>/blast on the right panel, then drag and drop files between your computer and Uppmax.

Use man scp to show the manual for scp.

Challenge

Challenge 1.2.2: Use copy/paste

A quick and dirty method is to open a graphical text editor on the remote server and paste the information in it. One such tool is gedit. Paste the content of the file into gedit and save it in the appropriate folder, under rpoB_ecoli.fasta.

On UPPMAX

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/blast
gedit rpoB_ecoli.fasta &

The & executes the program in the background, leaving you control of the command line.

Challenge

Challenge 1.2.3: Extract sequence from database

Since you know the accession number of the sequence to be used as a query, you can use the blast tools to extract that specific sequence from one of the databases available at UPPMAX. The tool in question is blastdbcmd. That specific sequence is presumably present in multiple databases. In doubt, one could search nr. But since E. coli K-12 is present in the tiny landmark database, you can use that one.

Put the sequence, in FASTA format, into a file called rpoB_ecoli.fasta

The manual for blastdbcmd can be obtained with:

BASH

blastdbcmd -help

If you have closed your session, you may need to use module load to load the appropriate module.

You may want to look into -db and -entry arguments.

BASH

blastdbcmd -db <db name> -entry <accession> > <file>

You should use the -db option and the -entry one.

Challenge

Challenge 1.2.4 (optional): Size of databases

Can you figure out a way to find the size of these two databases? How does it affect the time to retrieve information from them? Is it worth thinking about it?

You can look at the size of the databases by using blastdbcmd and the flag -info. To see how much time it takes to retrieve that single sequence from either database, use the command time in front of the command:

BASH

blastdbcmd -db <db> -info

time blastdbcmd -db <db> -entry <accession> > /dev/null

OUTPUT

Database: Landmark database for SmartBLAST
	403,974 sequences; 229,101,880 total residues

Date: Oct 17, 2023  5:37 PM	Longest sequence: 35,991 residues

[...]

Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects
	721,441,320 sequences; 277,730,601,621 total residues

Date: Feb 25, 2024  2:57 AM	Longest sequence: 98,182 residues

[...]
real	0m1.369s     # for landmark
[...]
real	0m10.059s.   # for nr

Task 1.3: Finding homologs to RpoB with BLAST

Now we have a query to start our search. Check that the file is present (ls) and that it looks like a FASTA file (less).

OUTPUT

>WP_000263098.1 unnamed protein product [Escherichia coli] >NP_312937.1 RNA polymerase beta subunit [Escherichia coli O157:H7 str. Sakai]
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVF
[...]

The file header might look slightly different, depending on how you obtained it. Now use blastp to find homologs of the RpoB protein. Use the help for blastp to explore the options you need to set.

Challenge

Challenge 1.3.1: Use blastp to find homologs in the landmark database

The path to the databases is already set correctly by the modules load blast command. See echo $BLASTDB to display it. Put the results into a file called rpoB_landmark.blast

Use the following command to find options. Explore -database

BASH

blastp -help

BASH

blastp -db <db> -query <fasta file> > <output file>

Explore the results of the blastp command by displaying the file in which you put the output of blastp. Inspect the alignments, including those at the bottom of file, which have worse alignments. In particular look at the E-values: do all hits look like true homologs? How can you change that?

Challenge

Challenge 1.3.2: Use blastp to find better homologs

Find the right option to change the E-value threshold to include hits. What is the default E-value? What does that mean?

Try to rerun the blastp search with a more reasonable value than the default.

As a rule of thumb, hits that have a E-value < 1e-6 are bona fide homologs. Look at the -evalue option.

BASH

blastp -db <db> -query <fasta_file> -evalue <evalue> > output

Explore the results again. Is it better, even the last alignments?

The default format of the blast output is “human-friendly”, something that resembles the output that is created on the NCBI website. To produce an output that is even closer to NCBI’s output, use the -html option.

The default format is fine for visual inspection, but not very convenient for computers to read. For example, in some cases you might want to perform data analysis on the output, e.g. to sort the results further or to compare the output of different runs. In that case, a tabular-like output is to prefer. The main option is -outfmt, and setting it to 6 will produce such a tabular output. The columns can be further specified, see the manual.

Challenge

Challenge 1.3.3: Explore the output format of BLAST

Play with the different options for outfmt, the different formats and how to customize the tabular formats (6, 7 and 10).

Finally, produce a standard tabular output for the same run as above and put the result into a file called rpoB_landmark.tab. This file can then downloaded to your own computer and opened with R or with Excel.

Note that the query sometimes yields several hits in the same query protein. This is caused by the protein being long and having its different domains being separated by less conserved domains.

blastp command:

BASH

blastp -db <db> -query <fasta file> -evalue <e-value> -outfmt <number> > <output_file>

To import the file to your computer, to the current directory, use the same scp program as above. This should be run on your own computer, not from UPPMAX.

BASH

scp <username>@rackham.uppmax.uu.se:<course base folde>/3MK013/<username>/blast/<file> .

Task 1.4: Use a larger database

So far you have used the landmark database, which is tiny. Now, use a different, larger database, to gather more results from a broader set of bacteria. Run a blastp again. How many significant hits do you find in these?

Challenge

Challenge 1.4.1: Larger database

refseq_select_prot and refseq_protein are good candidates. The former is smaller than the latter. Note that these two runs will take time, so run only the one to refseq_select_prot. We will run it in the background (adding a & at the end of the command) so that you can continue with other tasks and come back to that one later.

You can check whether blastp is still running by typing ps:

BASH

ps

OUTPUT

  PID TTY          TIME CMD
13920 pts/64   00:00:00 bash
33117 pts/64   00:00:00 blastp
35427 pts/64   00:00:00 ps

If you see blastp there, it means it is still running. It could take up to 30 minutes. When blastp is done, count the number of hits obtained.

The list of locally available databases is listed here: https://docs.uppmax.uu.se/databases/blast/

BASH

blastp -db <db> -query <fasta file> -evalue <e-value> -outfmt 6 > rpoB_<db>.tab &

When it has finished (it may take up to 30 minutes), count the rows to have the number of hits:

BASH

wc -l rpoB_<db>.tab

OUTPUT

500 rpoB_refseq_select.tab

You have actually hit the maximum number of aligned sequences to keep by default (500). You could change that by using the -max_target_seqs option and setting it to a larger number.

Task 1.5: Extract the sequences from the database

You found hits, i.e. proteins that show similarity with the query protein. To prepare for the next steps (multiple sequence alignment and building trees), you will need to retrieve the actual proteins and put them in a FASTA file. The simplest way is to directly extract them from the database, using the same tool (blastdbcmd) as above. You will first need to extract a list of the accession numbers from the blast results.

Challenge

Challenge 1.5.1: Extract the sequences with blastdbcmd

Use blastdbcmd to retrieve the accession ids from the landmark database. To prepare the list of proteins to extract, cut the blast results to keep the accession number of the hits. As you noticed above, there are multiple hits per protein and one hit per line, resulting in each subject protein being possibly present several times. You will need to produce a non-redundant list of ids.

BASH

blastdbcmd -help
man uniq
man sort

The second column of the default tabular output provides the accession id. cut the tabular output of the blast file, pipe it to sort and then to uniq, and send the result in a file. Then use that file as a input to blastcmd to extract the proteins. Last time we used -entry because we had just one, but there is another argument that takes a list of entries instead. Put the result in the rpoB_homologs.fasta file.

BASH

cut -f2 <blast_output_file> | sort | uniq > <id_file> 
blastdbcmd -db <db> -entry_batch <id_file> > rpoB_homologs.fasta
Challenge

Challenge 1.5.2: Count the sequences

Can you count how many sequences were included in the fasta file? Use grep and your knowledge of the FASTA format.

BASH

man grep
man wc

You can take a look at the sequences that were included in the blast:

BASH

grep ">" <fasta_file> | less

And then count them by piping the result to wc instead.

There should be around 70 sequences.

OUTPUT

70

For the upcoming episode on multiple sequence alignment, you will use a subset of these.

Exercise 2: Using PSI-BLAST to retrieve distant homologs of proteins


In this exercise, you will use another flavor of BLAST to retrieve distant homologs of a protein. As an example, we will use the protein RavC, present in the genomes of Legionella bacteria. This protein is an effector protein, injected by Legionella into the cytoplasm of their host (protists). The exact function is unknown, but it is presumably important, as it is conserved throughout the whole order Legionellales. Many effectors found in this group are derived from eukaryotic proteins, and this is what you will test here: does RavC have a homolog in eukarotes?

The strategy is to use psiblast, which uses - instead of a single query - a matrix of amino-acid frequencies as a query. psiblast is an iterative program: you generally start with one sequence, gather bona fide homologs, use the profile of these to query the database again, gather new homologs, recalculate the profile, then re-query the database, etc. The search may converge after a certain number of iterations, i.e. there no more new homologs to find with the latest profile.

In this case, you will use a slightly different strategy: you will start with one sequence, align it to refseq_select_prot but only to sequences in the order Legionellales, using the taxids options that limits the taxonomic scope of the search. You will save the profile (PSSM) generated by the first psiblast round and reuse this to then query the whole database, with three iterations.

Task 2.1: Extract RavC from a database

As above, you will extract the sequence of RavC from a database. This time you will use refseq_select_prot, since there are no Legionella in landmark. The accession number of RavC that you will use is WP_010945868.1.

Challenge

Challenge 2.1.1: Extract RavC

Retrieve sequence WP_010945868.1 from the refseq_protein database and put it into a file called ravC_LP.fasta. Check the content of the FASTA file.

blastdbcmd -help

BASH

blastdbcmd -db <db> -entry <accession> > <output_file>

OUTPUT

>WP_010945868.1 RMD1 family protein [Legionella pneumophila] >ERH46094.1 hypothetical protein N750_05210 [Legionella pneumophila str. Leg01/53] >ERH46577.1 hypothetical protein N751_07400 [Legionella pneumophila str. Leg01/11] >ERI48669.1 hypothetical protein N749_09265 [Legionella pneumophila str. Leg01/20] >MFO2512789.1 RMD1 family protein [Legionella pneumophila serogroup 2] >MFO2594790.1 RMD1 family protein [Legionella pneumophila serogroup 3] >MFO2645706.1 RMD1 family protein [Legionella pneumophila serogroup 8] >MFO2989133.1 RMD1 family protein [Legionella pneumophila serogroup 6] >MFO3234997.1 RMD1 family protein [Legionella pneumophila serogroup 5] >MFO3476243.1 RMD1 family protein [Legionella pneumophila serogroup 7] >MFO8588967.1 RMD1 family protein [Legionella pneumophila serogroup 14] >MFO8774718.1 RMD1 family protein [Legionella pneumophila serogroup 10] >MFP3789783.1 RMD1 family protein [Legionella pneumophila serogroup 9]
MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNKDHTLFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDK
PVALLVHDEFHYQIGDKTAIEPHGFYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGE
MPISRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAINHRLDTLNEIFDMFNGYLE
SRHGHHLEIIIIVLIAVEIIIAVMNFHF

Task 2.2: Align RavC to sequences belonging to Legionellales

That task is a bit complex, so let’s break it down in several steps. You will:

  1. align the RavC sequence to the refseq_select_prot database, using psiblast, and put the result into the file ravC_Leg.psiblast.
  2. save the PSSM (the amino-acid profile built by psiblast) after the last round, both in its “native” form and in text format.
  3. filter hits so that only hits with E-value < 1e-6 are shown
  4. filter hits so that only hits with E-value < 1e-10 are included in the PSSM
  5. filter hits so that only hits belonging to the order Legionelalles are included
Challenge

Challenge 2.2.1: Psiblast

Build the command, using the psiblast command, the query you extracted above and the refseq_select_prot database.

Caution

Don’t run the command yet, as this will run for a while! We are just building the command now. Wait for the end of the section.

BASH

psiblast -help

That is the base of the command:

BASH

psiblast -query <fasta file> -db <db> > ravC_Leg.psiblast
Challenge

Challenge 2.2.2: Saving the PSSM

Now add the options to save the PSSM after the last round, and save the PSSM both as binary and ascii form. Add these options to the command above, but you will only run it when it is finished.

In the PSI-blast help there is a “PSI-BLAST options” section.

For long help pages, it is sometimes useful to pipe the help message to grep and use a combination of -A (after), -B (before), and --color (color matches).

BASH

psiblast -help
psiblast -help | grep --color -B 5 -A 2 pssm

BASH

psiblast -query <fasta_file> -db <db> -save_pssm_after_last_round -out_pssm <pssm_file> -out_ascii_pssm <pssm_file.txt> > ravC_Leg.psiblast
Challenge

Challenge 2.2.3: Thresholds

Now add the E-value thresholds. You want to display hits with E-value < 1e-6, but only include those with E-value < 1e-10. Add the options to the rest.

BASH

psiblast -query <fasta_file> -db <db> -save_pssm_after_last_round -out_pssm <pssm_file> -out_ascii_pssm <pssm_file.txt> -inclusion_ethresh <evalue> -evalue <evalue> > ravC_Leg.psiblast
Challenge

Challenge 2.2.4: Taxonomic range

Now limit the results to the order Legionellales. Find the taxid of this group on the NCBI website.

Note: this feature has been upgraded in the latest version of BLAST (2.15.0+). It is now possible to include all descendants of a single taxid, using only that taxid. In previous versions of BLAST, you had to include all descending taxids using a script.

Check out the Taxonomy section of NCBI: https://www.ncbi.nlm.nih.gov/Taxonomy/

https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?mode=Info&id=118969&lvl=3&lin=f&keep=1&srchmode=1&unlock

BASH

psiblast -query <fasta_file> -db <db> -save_pssm_after_last_round -out_pssm <pssm_file> -out_ascii_pssm <pssm_file.txt> -inclusion_ethresh <evalue> -evalue <evalue> -taxids <taxid> > ravC_Leg.psiblast
Discussion

Challenge 2.2.5: Running the command and examining the results

Run now the full command as above. When it’s done, look at the resulting files. There should be three of them. Take some time to explore these three files, especially the alignments resulting from the psiblast.

Task 2.3: Align the PSSM to the whole database

You will now take the resulting PSSM and use that as a query to perform a psiblast against the whole refseq_select_prot database (not only against Legionellales). You want to perform max 10 iterations (the search will stop if it converges before the tenth iteration), and increase the max number of target sequences to gather to 1000 per iteration. You also want to change the output to a tabular form with comments and add more columns to get into more details.

Challenge

Challenge 2.3.1: Align the PSSM, set E-value thresholds, iteration and max sequences

Build the command as above, but don’t set the -query option, use the option that allows to input a PSSM instead. Set the E-value thresholds as above, the number of iterations to 10 and the maximum number of sequences to gather to 1000 (per round). Direct the result to the file ravC_all.psiblast.

Don’t run it yet, more options to come.

BASH

psiblast -help
psiblast -help | grep --color -B 5 -A 2 pssm

BASH

psiblast -in_pssm <binary pssm file> -db <db> -inclusion_ethresh <evalue> -evalue <evalue> -max_target_seqs <number> -num_iterations 10 > ravC_all.psiblast
Challenge

Challenge 2.3.2: Set the output format

You want to have a tabular result format with comments, to help you understand the output. You also want to use the standard columns but add the query coverage per subject, the scientific and common name of the subject sequence, as well as which super-kingdom (or domain) it belongs to.

Inspect the “Formatting options” section of the psiblast help page.

The correct -outfmt is 7. The string with the correct columns is composed with this number and then column names, separated by spaces, the whole enclosed by double quotes. An example in the help file of psiblast is "10 delim=@ qacc sacc score"

psiblast -in_pssm -db -inclusion_ethresh -evalue -max_target_seqs -num_iterations 10 -outfmt “ …” > ravC_all.psiblast

Discussion

Challenge 2.3.3: Run the command and examine the results

This will take a while to run, maybe 30 minutes. When done, open the result file and examine it. Did you find hits in the eukaryotes?

Key Points
  • Using BLAST is a blast!
  • Choice of database is a crucial trade-off between efficiency and sensitivity