BLAST
Last updated on 2026-04-01 | Edit this page
Overview
Questions
- How to use the command-line version of
BLAST?
Objectives
- Run different flavors of
BLAST - Use different databases
- Use profile-based
BLASTto retrieve distant homologs
Introduction
The goal of this exercise is to practice with the command line-based
version of BLAST. It is also the first step in building
phylogenetic trees, namely by gathering homologous sequences that will
then be aligned. The alignment is finally used to build a tree.
The whole exercise is based on RpoB, the β-subunit of the bacterial RNA polymerase. This protein is essential to the cell, and present in all bacteria and plastids. It is also very conserved, and thus suitable for deep-scale phylogenies.
BLAST
BLAST (basic local alignment search tool, also referred
to as the Google of biological research) is one of the most widely used
tools in bioinformatics. The wide majority of its uses can be performed
online, but for larger searches, batches or advanced uses, the command
line version, performed locally on a computer or cluster, is
indispensable.
Resources at UPPMAX
BLAST is available at UPPMAX. To load the
BLAST+ module, as it is knonw in Pelle, use the
module load command. In the same command, also load the
BLAST_databases module, to be able to use the standard
databases that NCBI maintains.
Databases available at UPPMAX are described here: https://docs.uppmax.uu.se/databases/blast/. The
BLAST_databases module implies that you don’t need to
specify where the databases are located on the file system. In detail,
it sets the BLASTDB variable to the right folder. You can
see it by typing echo $BLASTDB in the terminal.
Gene and protein records are usually associated with a
taxid, to describe what organisms they come from. This can
be very useful to limit the search to a certain taxon, or to exclude
another taxon. E.g. if you want to investigate whether a certain gene
has been transferred from bacteria to archaea: you would search for that
specific by excluding all bacteria and eukaryotes.
Taxonomy resources at UPPMAX are described here: https://docs.uppmax.uu.se/databases/ncbi/
Exercise 0: Login to Uppmax
This is just a reminder of the introduction to Linux and how to login to Uppmax.
Challenge 0.1
Login to Uppmax and navigate to the course folder, create a folder
for a blast exercise.
Remember the best practices you learned for file naming.
All exercises should be performed inside
/proj/g2020004/nobackup/3MK013/<username> where
<username> is your own folder.
ssh is used to connect to an external server.
-Y forwards the graphical display to your computer. The
address of the server is pelle.uppmax.uu.se. You need to
add your user name in front of it, with a @ in between.
The course folder is at
/proj/g2020004/nobackup/3MK013/.
There, make a folder with your username.
Inside it, create a blast folder for this exercise.
Challenge 0.2
Access an interactive session that is booked for us. The
session is uppmax2026-1-93. Use the pelle
cluster, for 4 hours.
Exercise 1: Finding and retrieving homologs
Here, you will first find the protein query to start your search with. You will test different methods to create a file containing only RpoB from E. coli. Then, you will use that file as a query to find homologs of RpoB in different databases.
Task 1.1: Retrieve the RpoB sequence for E. coli
First, use your recently acquired NCBI-fu to
retrieve the sequence from E. coli K-12. There are many
genomes, and thus many identical proteins, grouped into Identical Protein Groups.
NCBI’s databases are (almost) non-redundant (that’s where the name of
the largest protein database, nr comes from), and thus only
one representative per IPG is present. Thus search in IPG, and find the
IPG’s accession number. Write down the accession number somewhere.
Challenge 1.1.1: Finding E. coli’s RpoB
Find the accession number for the IPG containing the RpoB sequence of
E. coli K-12, and download the sequence in FASTA
format.
The accession number is WP_000263098.1.
The sequence in fasta format can be downloaded at https://www.ncbi.nlm.nih.gov/protein/ by searching the
accession number clicking on the “Send to” link and then choosing
FASTA format. Save the file under
rpoB_ecoli.fasta.
The fasta file should look like:
>WP_000263098.1 MULTISPECIES: DNA-directed RNA polymerase subunit beta [Enterobacteriaceae]
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQY
VSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVING
Task 1.2: Push the sequence to UPPMAX
The sequence is located on your computer, and you need to transfer it
to your computer. You will test several methods to push it to UPPMAX, to
be able to use it as a query for BLAST.
Challenge 1.2.1: Use scp
scp, secure file copy, is a tool to copy files via SSH,
the same protocol you use to login to UPPMAX. You can use it on your
computer with the following syntax:
The remote file location can be a relative path from your home or an
absolute path, starting with /.
To bring up a local terminal on your Windows computer, click on the
“+” sign on the main window of MobaXTerm. If that doesn’t work, use
SFTP. Click on Session, SFTP, and fill in the Remote host as usual
pelle.uppmax.uu.se and your username. Navigate to
/proj/g2020004/nobackup/3MK013/<username>/blast on
the right panel, then drag and drop files between your computer and
Uppmax.
Use man scp to show the manual for scp.
Challenge 1.2.2: Use copy/paste
A quick and dirty method is to open a graphical text editor on the
remote server and paste the information in it. One such tool is
nedit. Paste the content of the file into
nedit and save it in the appropriate folder, under
rpoB_ecoli.fasta.
Challenge 1.2.3: Extract sequence from database
Since you know the accession number of the sequence to be used as a
query, you can use the blast tools to extract that specific
sequence from one of the databases available at UPPMAX. The tool in
question is blastdbcmd. That specific sequence is
presumably present in multiple databases. In doubt, one could search
nr. But since E. coli K-12 is present in the tiny
landmark
database, you can use that one.
Put the sequence, in FASTA format, into a file called
rpoB_ecoli.fasta
The manual for blastdbcmd can be obtained with:
If you have closed your session, you may need to use
module load to load the appropriate module.
You may want to look into -db and -entry
arguments.
You should use the -db option and the
-entry one.
Challenge 1.2.4 (optional): Size of databases
Can you figure out a way to find the size of these two databases? How does it affect the time to retrieve information from them? Is it worth thinking about it?
You can look at the size of the databases by using
blastdbcmd and the flag -info. To see how much
time it takes to retrieve that single sequence from either database, use
the command time in front of the command:
OUTPUT
Database: Landmark database for SmartBLAST
506,514 sequences; 311,806,943 total residues
Date: Aug 6, 2025 4:19 AM Longest sequence: 35,991 residues
[...]
Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects
1,008,714,371 sequences; 383,393,166,825 total residues
Date: Feb 24, 2026 4:54 AM Longest sequence: 98,182 residues
[...]
real 0m0.417s # for landmark
[...]
real 0m5.418s # for nr
Task 1.3: Finding homologs to RpoB with BLAST
Now we have a query to start our search. Check that the file is
present (ls) and that it looks like a FASTA
file (less).
OUTPUT
>WP_000263098.1 unnamed protein product [Escherichia coli] >NP_312937.1 RNA polymerase beta subunit [Escherichia coli O157:H7 str. Sakai]
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVF
[...]
The file header might look slightly different, depending on how you
obtained it. Now use blastp to find homologs of the RpoB
protein. Use the help for blastp to explore the options you
need to set.
Challenge 1.3.1: Use blastp to
find homologs in the landmark database
The path to the databases is already set correctly by the
modules load blast command. See echo $BLASTDB
to display it. Put the results into a file called
rpoB_landmark.blast
Explore the results of the blastp command by displaying
the file in which you put the output of blastp. Inspect the
alignments, including those at the bottom of file, which have worse
alignments. In particular look at the E-values: do all hits look like
true homologs? How can you change that?
Challenge 1.3.2: Use blastp to
find better homologs
Find the right option to change the E-value threshold to include hits. What is the default E-value? What does that mean?
Try to rerun the blastp search with a more reasonable
value than the default.
As a rule of thumb, hits that have a E-value < 1e-6 are bona
fide homologs. Look at the -evalue option.
Explore the results again. Is it better, even the last alignments?
The default format of the blast output is
“human-friendly”, something that resembles the output that is created on
the NCBI website. To produce an output that is even closer to NCBI’s
output, use the -html option.
The default format is fine for visual inspection, but not very
convenient for computers to read. For example, in some cases you might
want to perform data analysis on the output, e.g. to sort the results
further or to compare the output of different runs. In that case, a
tabular-like output is to prefer. The main option is
-outfmt, and setting it to 6 will produce such
a tabular output. The columns can be further specified, see the
manual.
Challenge 1.3.3: Explore the output format of
BLAST
Play with the different options for outfmt, the different formats and how to customize the tabular formats (6, 7 and 10).
Finally, produce a standard tabular output for the same run as above
and put the result into a file called rpoB_landmark.tab.
This file can then downloaded to your own computer and opened with
R or with Excel.
Note that the query sometimes yields several hits in the same query protein. This is caused by the protein being long and having its different domains being separated by less conserved domains.
blastp command:
To import the file to your computer, to the current directory, use
the same scp program as above. This should be run
on your own computer, not from UPPMAX.
Task 1.4: Use a larger database
So far you have used the landmark database, which is
tiny. Now, use a different, larger database, to gather more results from
a broader set of bacteria. Run a blastp again. How many
significant hits do you find in these?
Challenge 1.4.1: Larger database
refseq_select_prot and refseq_protein are
good candidates. The former is smaller than the latter. Note that these
two runs will take time, so run only the one to
refseq_select_prot. We will run it in the background
(adding a & at the end of the command) so that you can
continue with other tasks and come back to that one later.
You can check whether blastp is still running by typing
ps:
OUTPUT
PID TTY TIME CMD
13920 pts/64 00:00:00 bash
33117 pts/64 00:00:00 blastp
35427 pts/64 00:00:00 ps
If you see blastp there, it means it is still running.
It could take up to 30 minutes. When blastp is done, count
the number of hits obtained.
The list of locally available databases is listed here: https://docs.uppmax.uu.se/databases/blast/
When it has finished (it may take up to 30 minutes), count the rows to have the number of hits:
OUTPUT
500 rpoB_refseq_select.tab
You have actually hit the maximum number of aligned sequences to keep
by default (500). You could change that by using the
-max_target_seqs option and setting it to a larger
number.
Task 1.5: Extract the sequences from the database
You found hits, i.e. proteins that show similarity with the query
protein. To prepare for the next steps (multiple sequence alignment and
building trees), you will need to retrieve the actual proteins and put
them in a FASTA file. The simplest way is to directly
extract them from the database, using the same tool
(blastdbcmd) as above. You will first need to extract a
list of the accession numbers from the blast results.
Challenge 1.5.1: Extract the sequences with
blastdbcmd
Use blastdbcmd to retrieve the accession ids from the
landmark database. To prepare the list of proteins to
extract, cut the blast results to keep the accession number
of the hits. As you noticed above, there are multiple hits per protein
and one hit per line, resulting in each subject protein being possibly
present several times. You will need to produce a non-redundant list of
ids.
The second column of the default tabular output provides the
accession id. cut the tabular output of the blast file,
pipe it to sort and then to uniq, and send the
result in a file. Then use that file as a input to blastcmd
to extract the proteins. Last time we used -entry because
we had just one, but there is another argument that takes a list of
entries instead. Put the result in the rpoB_homologs.fasta
file.
Challenge 1.5.2: Count the sequences
Can you count how many sequences were included in the fasta file? Use
grep and your knowledge of the FASTA
format.
Exercise 2: Using PSI-BLAST to retrieve distant homologs of proteins
In this exercise, you will use another flavor of BLAST
to retrieve distant homologs of a protein. As an example, we will use
the protein RavC, present in the genomes of Legionella
bacteria. This protein is an effector protein, injected by
Legionella into the cytoplasm of their host (protists). The
exact function is unknown, but it is presumably important, as it is
conserved throughout the whole order Legionellales. Many
effectors found in this group are derived from eukaryotic proteins, and
this is what you will test here: does RavC have a homolog in
eukarotes?
The strategy is to use psiblast, which uses - instead of
a single query - a matrix of amino-acid frequencies as a query.
psiblast is an iterative program: you generally start with
one sequence, gather bona fide homologs, use the profile of
these to query the database again, gather new homologs, recalculate the
profile, then re-query the database, etc. The search may converge after
a certain number of iterations, i.e. there no more new homologs to find
with the latest profile.
In this case, you will use a slightly different strategy: you will
start with one sequence, align it to refseq_select_prot but
only to sequences in the order Legionellales, using the
taxids options that limits the taxonomic scope of the
search. You will save the profile (PSSM) generated by the first
psiblast round and reuse this to then query the whole
database, with three iterations.
Task 2.1: Extract RavC from a database
As above, you will extract the sequence of RavC from a database. This
time you will use refseq_select_prot, since there are no
Legionella in landmark. The accession number of
RavC that you will use is WP_010945868.1.
Challenge 2.1.1: Extract RavC
Retrieve sequence WP_010945868.1 from the
refseq_protein database and put it into a file called
ravC_LP.fasta. Check the content of the FASTA
file.
blastdbcmd -help
OUTPUT
>WP_010945868.1 RMD1 family protein [Legionella pneumophila]
MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNKDHTLFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDK
PVALLVHDEFHYQIGDKTAIEPHGFYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGE
MPISRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAINHRLDTLNEIFDMFNGYLE
SRHGHHLEIIIIVLIAVEIIIAVMNFHF
Task 2.2: Align RavC to sequences belonging to Legionellales
That task is a bit complex, so let’s break it down in several steps. Let’s build and use a PSSM matrix, the amino-acid profile built by psiblast. The matrix is a way to represent a multiple-sequence alignment in a statistical way. In brief, each column (or position) of the alignment is represented by a vector of the probabilities to find each nucleotide (or amino-acid) at that position.
You will:
- align the RavC sequence to the
refseq_select_protdatabase, usingpsiblast, and put the result into the fileravC_Leg.psiblast. - save the PSSM matrix after the last round, both in its “native” form and in text format.
- filter hits so that only hits with E-value < 1e-6 are shown
- filter hits so that only hits with E-value < 1e-10 are included in the PSSM
- filter hits so that only hits belonging to the order Legionelalles are included
Challenge 2.2.1: Psiblast
Build the command, using the psiblast command, the query
you extracted above and the refseq_select_prot
database.
Don’t run the command yet, as this will run for a while! We are just building the command now. Wait for the end of the section.
Challenge 2.2.2: Saving the PSSM
Now add the options to save the PSSM after the last round, and save the PSSM both as binary and ascii form. Add these options to the command above, but you will only run it when it is finished.
Challenge 2.2.3: Thresholds
Now add the E-value thresholds. You want to display hits with E-value < 1e-6, but only include those with E-value < 1e-10. Add the options to the rest.
Challenge 2.2.4: Taxonomic range
Now limit the results to the order Legionellales. Find the taxid of this group on the NCBI website.
Note: this feature has been upgraded in the latest version of
BLAST (2.15.0+). It is now possible to include all
descendants of a single taxid, using only that taxid. In previous
versions of BLAST, you had to include all descending taxids
using a script.
Check out the Taxonomy section of NCBI: https://www.ncbi.nlm.nih.gov/Taxonomy/
Challenge 2.2.5: Running the command and examining the results
Run now the full command as above. When it’s done, look at the
resulting files. There should be three of them. Take some time to
explore these three files, especially the alignments resulting from the
psiblast.
Task 2.3: Align the PSSM to the whole database
You will now take the resulting PSSM and use that as a query to
perform a psiblast against the whole
refseq_select_prot database (not only against
Legionellales). You want to perform max 10 iterations (the
search will stop if it converges before the tenth iteration), and
increase the max number of target sequences to gather to 1000 per
iteration. You also want to change the output to a tabular form with
comments and add more columns to get into more details.
Challenge 2.3.1: Align the PSSM, set E-value thresholds, iteration and max sequences
Build the command as above, but don’t set the -query
option, use the option that allows to input a PSSM instead. Set the
E-value thresholds as above, the number of iterations to 10 and the
maximum number of sequences to gather to 1000 (per round). Direct the
result to the file ravC_all.psiblast.
Don’t run it yet, more options to come.
Challenge 2.3.2: Set the output format
You want to have a tabular result format with comments, to help you understand the output. You also want to use the standard columns but add the query coverage per subject, the scientific and common name of the subject sequence, as well as which super-kingdom (or domain) it belongs to.
Inspect the “Formatting options” section of the psiblast
help page.
The correct -outfmt is 7. The string with the correct
columns is composed with this number and then column names, separated by
spaces, the whole enclosed by double quotes. An example in the help file
of psiblast is "10 delim=@ qacc sacc score"
Challenge 2.3.3: Run the command and examine the results
This will take a while to run, maybe 30 minutes. When done, open the result file and examine it. Did you find hits in the eukaryotes?
Getting impatient? You can examine an already-made file obtained with the same command. It is available at:
- Using BLAST is a blast!
- Choice of database is a crucial trade-off between efficiency and sensitivity