Content from NCBI


Last updated on 2026-04-01 | Edit this page


Overview

Questions

Exercise 1 - How do you efficiently and reliably navigate NCBI’s website?

Exercise 2 - How do you search sequences? - How do you use the right BLAST flavor?

Objectives

Exercise 1 - Familiarize yourself with the differences NCBI databases - Browse and search the databases, using cross-links

Exercise 2 - Use and understand blast alignment tools - Characterize sequences - Understand genomic context and synteny

This part is to encourage you to explore NCBI resources. Questions are examples or real-life questions that you might ask yourself later. There are not necessarily exactly one solution to the question.

Start by going to NCBI’s web site, main search page: https://www.ncbi.nlm.nih.gov/search/. There, you have the list of most of NCBI’s databases, sorted by category. Take some time to explore the following sections: Literature, Genomes, Genes and Proteins.

Task 1.1: Find publications (this is a warm up!)

You want to find the following articles:

  1. an article about Escherichia coli O104:H4 published by Matthew K Waldor in the New England Journal of Medicine; and
  2. a paper that has Escherichia coli in the title, whose last author is L. Wang, and was published in PLoS ONE in 2014.

NOTE: you do not know the exact title, list of authors, PMID etc. Use your search skills (solution provided below). There may be more than one result.

Challenge

Challenge 1.1.1

Find the two articles above using NCBI’s literature database.

Use the advanced search from PubMed, by clicking on “Advanced” (tutorial https://www.ncbi.nlm.nih.gov/books/NBK3827/#pubmedhelp.PubMed_Quick_Start), to build an exact search. Use the different fields to build a search that returns only a single match. In particular, look at the Search field tags.

Use search terms with search tags (“search term”[searchTag]“)and combine them with Boolean operators (”AND”).

Useful search tags: Author [au], Date of publication [dp], Journal [ta], Last author [lastau], Title [ti].

  1. Waldor[au] AND “Escherichia coli O104:H4” AND NEJM[ta]
  2. “Wang L”[lastau] AND “Escherichia coli”[ti] AND 2014[dp] and “PLOS One”[ta].
Discussion

Challenge 1.1.2

Now try to find the most recent paper citing the first article by Rasko et al above. Compare the use of

Then:

  • How did the two search engines compare?
  • Which one was easier to work with dates?
  • Which one returned most results?
  • Which one has more complete information?

Task 1.2: Find Gene records

You want to find sequences for the subunit A of the Shiga toxin in E. coli O157:H7 Sakai. Try to search in the three following databases: Gene, Nucleotide and Protein.

Challenge

Challenge 1.2.1

What do the three different databases contain? What information do you get from them?

NCBI is not as smart as Google, and copy/pasting might fail. Try spelling out Escherichia coli and removing parts of the search text.

If you get too many hits, go to the field “Search details”, and refine your search, using the [Organism] field, for example. You don’t need to get exactly one hit or to get the result you want on top. By default, the search will include everything that has the species name anywhere in the record.

Nucleotide database contains mostly genome records, so the Shiga toxin gene might be anywhere on these contigs/genomes.

Discussion

Challenge 1.2.2

What do the five top results from the Protein database show?

Task 1.3: Understand Gene records

Click on a Gene search result from Task 1.2 and skim through the entire page.

Challenge

Challenge 1.3.1

Who published the sequence? When? Is there a paper?

There is often a “Bibliography” section. There is also often a “PubMed” link under “Related Information” in the right menu.

Challenge

Challenge 1.3.2

What is known about the gene? Does the record include taxonomy information?

The taxonomic information is under the “Summary” section, under “Organism” and “Lineage”.

Click on the Organism link and go to the Taxonomy Browser.

Discussion

Challenge 1.3.3

What can you learn about species taxonomy there? What other useful information is given on this page?

Back to the Gene page, have a look at the “Related information” section in the right column.

Challenge

Challenge 1.3.4

Where can you go from there?

All the information in that section (“Related information”) is coming through the Entrez system. In GenBank records, look for \dbxref (database cross-reference) which provides the Entrez links.

Task 1.4: Understanding Protein records and sequences

Click on the Protein link for this gene. Look at the content of one of the records.

Challenge

Challenge 1.4.1

What can you learn here? What information do you find here? What is the name of this format? Are there any known protein domains in this protein? Can you identify a link to these?

You can change the format by clicking on the top left corner.

Look also for “Related information” in the right menu and for the /db_xref links in the main file.

Challenge

Challenge 1.4.2

Can you find only the sequence information in FASTA format? How is the format organized? What is included in the header? Discuss the advantages of the two formats. Can you find a definition of both formats on the NCBI website or elsewhere?

If you are stuck, here is the link to

Challenge

Challenge 1.4.3

Can you find a 3D protein structure for this protein?

Not all proteins have 3D structures. If your protein doesn’t have one, try the following Shiga toxin:

https://www.ncbi.nlm.nih.gov/protein/NP_309232.1

In the right menu, under “Related Information”, there may be a “Related Structures” link.

Challenge

Challenge 1.4.4

Can you display the genome record on which the gene is encoded?

If you lost the gene page, here is another one:

https://www.ncbi.nlm.nih.gov/gene/26516284

There are several ways to display the GenBank file. - In the “Genomic regions, transcripts, and products” section, there is a link to the GenBank record - There is another one in the “Related sequences” section (column “Accession and Version”).

Exercise 2: Sequence alignments


In this exericse, you will use the sequence alignment tool BLAST to align and retrieve sequences.

Caution

NOTE: the NCBI blast service can be under very heavy load (especially during daytime in the US), and don’t be surprised if a single blast takes >10 minutes. As an alternative, you can use the BLAST service at the EBI website (http://www.ebi.ac.uk). Note that the EBI doesn’t have the same level of tool integration as NCBI, and some parts of the questions might be more challenging to answer with the EBI tools.

In general, try reduce the load on the NCBI server and consider smaller databases than the standard nr/nt ones, for example refseq_select or refseq_protein: under the “Choose Search Set” heading on the Blast search page, you can choose the right “Database”.

Task 2.1: Find nucleotide blast hits

Find the NCBI blast main page.

Challenge

Challenge 2.1.1

  • What is BLAST?
  • What different kinds of BLAST searches are there?
  • What is blastn? blastx? blastp? tblastn?

Find sequence hits for the following sequence, but first consider the options available on the BLAST page. One option that might come in very handy is the “open results in another window” option, which will allow you to modify your query and rerun it quickly without losing the results:

>a
GATTACTTCAGCCAAAAGGAACACCTGTATATGAAGTGTATATTATTTAAATGGGTACTG
TGCCTGTTACTGGGTTTTTCTTCGGTATCCTATTCCCGGGAGTTTACGATAGACTTTTCG
ACCCAACAAAGTTATGTCTCTTCGTTAAATAGTATACGGACAGAGATATCGACCCCTCTT
GAACATATATCTCAGGGGACCACATCGGTGTCTGTTATTAACCACACCCCACCGGGCAGT
TATTTTGCTGTGGATATACGAGGGCTTGATGTCTATCAGGCGCGTTTTGACCATCTTCGT
CTGATTATTGAGCAAAATAATTTATATGTGGCCGGGTTCGTTAATACGGCAACAAATACT
TTCTACCGTTTTTCAGATTTTACACATATATCAGTGCCCGGTGTGACAACGGTTTCCATG
ACAACGGACAGCAGTTATACCACTCTGCAACGTGTCGCAGCGCTGGAACGTTCCGGAATG
CAAATCAGTCGTCACTCACTGGTTTCATCATATCTGGCGTTAATGGAGTTCAGTGGTAAT
ACAATGACCAGAGATGCATCCAGAGCAGTTCTGCGTTTTGTCACTGTCACAGCAGAAGCC
TTACGCTTCAGGCAGATACAGAGAGAATTTCGTCAGGCACTGTCTGAAACTGCTCCTGTG
TATACGATGACGCCGGGAGACGTGGACCTCACTCTGAACTGGGGGCGAATCAGCAATGTG
CTTCCGGAGTATCGGGGAGAGGATGGTGTCAGAGTGGGGAGAATATCCTTTAATAATATA
TCAGCGATACTGGGGACTGTGGCCGTTATACTGAATTGCCATCATCAGGGGGCGCGTTCT
GTTCGCGCCGTGAATGAAGAGAGTCAACCAGAATGTCAGATAACTGGCGACAGGCCCGTT
ATAAAAATAAACAATACATTATGGGAAAGTAATACAGCTGCAGCGTTTCTGAACAGAAAG
TCACAGTTTTTATATACAACGGGTAAATAAAGGAGTTAAGCATGAAGAAGATGTTTATGG
Challenge

Challenge 2.1.2

  • Is it a gene?
  • If yes, what does it encode?
  • What is the closest organism? What can you infer about its taxonomic distribution?

What does a protein-coding gene need to produce proteins?

Now go back to the blast main page.

Challenge

Challenge 2.1.3

  • Did you choose the right blast algorithm to answer the questions above?
  • Can you do better?

What if you try another flavor of the blast suite?

What if you aligned the gene to the genome while keeping the codon frame?

Repeat the procedure for this other sequence:

>b
GATTACTTCAGCCAAAAGGAACACCTGTATATGAAGTGTATATTATTTAAATGGGTACTG
TGCCTGTTACTGGGTTTTTCTTCGGTATCCTATTCCCGGGAGTTTACGATAGACTTTTCG
ACCCAACAAAGTTATGTCTCTTCGTTAAATAGTATACGGACAGAGATATCGACCCCTCTT
GAACATATATCTCAGGGGACCACATCGGTGTCTGTTATTAACCACACCCCACCGGGCAGT
TATTTTGCTGTGGATATACGAGGGCTTGATGTCTATCAGGCGCGTTTTGACCATCTTCGT
CTGATTATTGAGCAAAATAATTTATATGTGGCCGGGTTCGTTAATACGGCAACAAATACT
TTCTACCGTTTTTCAGATTTTACACATATATCAGTGCCCGGTGGACAACGGTTTCCATGA
CAACGGACAGCAGTTATACCACTCTGCAACGTGTCGCAGCGCTGGAACGTTCCGGAATGC
AAATCAGTCGTCACTCACTGGTTTCATCATATCTGGCGTTAATGGAGTTCAGTGGTAATA
CAATGACCAGAGATGCATCCAGAGCAGTTCTGCGTTTTGACTGTCACTGTCACAGCAGAA
GCCTTACGCTTCAGGCAGATACAGAGAGAATTTCGTCAGGCACTGTCTGAAACTGCTCCT
GTGTATACGATGACGCCGGGAGACGTGGACCTCTTTTTTTACTCTGAACTGGGGGCGAAT
CAGCAATGTGCTTCCGGAGTATCGGGGAGAGGATGGTGTCAGAGTGGGGAGAATATCCTT
TAATAATATATCAGCGATACTGGGGACTGTGGCCGTTATACTGAATTGCCATCATCAGGG
GGCGCGTTCTGTTCGCGCCGTGAATGAAGAGAGTCAACCAGAATGTCAGATAACTGGCGA
CAGGCCCGTTATAAAAATAAACAATACATTATGGGAAAGTAATACAGCTGCAGCGTTTCT
GAACAGAAAGTCACAGTTTTTATATACAACGGGTAAATAAAGGAGTTAAGCATGAAGAAG
ATGTTTATGG
Challenge

Challenge 2.1.4

How does sequence b compare to the first sequence? Is it also a gene?

If you get stuck, try e.g. StarORF (http://star.mit.edu/orf/index.html). You might get a warning

Challenge

Challenge 2.1.5

  • Can you perform a pairwise alignment between both sequences?
  • What are the differences?

Check the “Align two or more sequences” on the BLAST search page.

Task 2.2: Find protein blast hits

Now find sequences with similarity to this protein

>c
MMNRSIYRQFVRYTIPTVAAMLVNGLYQVVDGIFIGHYVGAEGLAGINVAWPVIGTILGIGMLVGVGTGA
LASIKQGEGHPDSAKRILATGLMSLLLLAPIVAVILWFMADDFLRWQGAEGRVFELGLQYLQVLIVGCLF
TLGSIAMPFLLRNDHSPNLATLLMVIGALTNIALDYLFIAWLQWELTGAAIATTLAQVVVTLLGLAYFFS
ARANMRLTRRCLRLEWHSLPKIFAIGVSSFFMYAYGSTMVALHNTLMIEYGNAVMVGAYAVMGYIVTIYY
LTVEGIANGMQPLASYHFGARNYDHIRKLLRLAMGIAVLGGMAFVLVLNLFPEQAIAIFNSSDSELIAGA
QMGIKLHLFAMYLDGFLVVSAAYYQSTNRGGKAMFITVGNMSIMLPFLFILPQFFGLTGVWIALPISNIV
LSTVVGIMLWRDVNKMGKPTQVSYA
Discussion

Challenge 2.2.1

  • What is this gene coding for?
  • Where did it likely come from?
Discussion

Challenge 2.2.2

  • Can you align nucleotide sequences (sequence a, Task 2.1) against a protein database?
  • If so, how?
Discussion

Challenge 2.2.3

  • Can you align proteins to a nucleotide database?
  • If so, how? If not, why not?

Task 2.3: Find gene and genome hits

This task should be performed at the NCBI page (not at EBI).

What is the following sequence?

>d
GTGTCTAAAGAAAAATTTGAACGTACAAAACCGCACGTTAACGTTGGTACTATCGGCCACGTTGACCACG
GTAAAACTACTCTGACCGCTGCAATCACCACCGTACTGGCTAAAACCTACGGCGGTGCTGCTCGTGCATT
CGACCAGATCGATAACGCGCCGGAAGAAAAAGCTCGTGGTATCACCATCAACACTTCTCACGTTGAATAT
GACACCCCGACCCGTCACTACGCACACGTAGACTGCCCGGGGCACGCCGACTATGTTAAAAACATGATCA
CCGGTGCTGCTCAGATGGACGGCGCGATCCTGGTAGTTGCTGCGACTGACGGCCCGATGCCGCAGACTCG
TGAGCACATCCTGCTGGGTCGTCAGGTAGGCGTTCCGTACATCATCGTGTTCCTGAACAAATGCGACATG
GTTGATGACGAAGAGCTGCTGGAACTGGTTGAAATGGAAGTTCGTGAACTTCTGTCTCAGTACGACTTCC
CGGGCGACGACACTCCGATCGTTCGTGGTTCTGCTCTGAAAGCGCTGGAAGGCGACGCAGAGTGGGAAGC
GAAAATCCTGGAACTGGCTGGCTTCCTGGATTCTTACATTCCGGAACCAGAGCGTGCGATTGACAAGCCG
TTCCTGCTGCCGATCGAAGACGTGTTCTCCATCTCCGGTCGTGGTACCGTTGTTACCGGTCGTGTAGAAC
GCGGTATCATCAAAGTTGGTGAAGAAGTTGAAATCGTTGGTATCAAAGAGACTCAGAAGTCTACCTGTAC
TGGCGTTGAAATGTTCCGCAAACTGCTGGACGAAGGCCGTGCTGGTGAGAACGTAGGTGTTCTGCTGCGT
GGTATCAAACGTGAAGAAATCGAACGTGGTCAGGTACTGGCTAAGCCGGGCACCATCAAACCGCACACCA
AGTTCGAATCTGAAGTGTACATTCTGTCCAAAGATGAAGGCGGCCGTCATACTCCGTTCTTCAAAGGCTA
CCGTCCGCAGTTCTACTTCCGTACTACTGACGTGACTGGTACCATCGAACTGCCGGAAGGCGTAGAGATG
GTAATGCCGGGCGACAACATCAAAATGGTTGTTACCCTGATCCACCCGATCGCGATGGACGACGGTCTGC
GTTTCGCAATCCGTGAAGGCGGCCGTACCGTTGGTGCGGGCGTTGTTGCTAAAGTTCTGGGCTAA
Challenge

Challenge 2.3.1

  • What organism is it likely from?
  • Is it a gene?
  • If yes, which one?
  • What does it code for?

Use rather blastn to identify the origin of the gene. Explore the alignments of the first hit, and try the “Graphics” button associated with the results.

Challenge

Challenge 2.3.2

  • Where is it located on the genome (precision at ~10kb is good enough)?
  • Are there several copies in the genome?

Mark down the name of the gene (generally three letters in lower case and one in uppercase). From the protein record, there is a link to the genome record, which has a “graphics” interface.

Not all genomes are equally well annotated and you might have to search for a genome that is well annotated. One good example is Escherichia fergusonii ATCC 35469

Challenge

Challenge 2.3.3

  • How far is this gene (and possible copies) from the origin of replication?
  • How is it oriented with respect to replication?

What genes are reliable markers for the origin of replication? Can you find a paper about that? Now can you find that gene in the genome above?

What is the dnaA gene doing?

Task 2.4 (optional): Explore the synteny functions of the STRING database

We are interested in genes that are normally located next to each other, and their taxonomic breadth.

Open the STRING database (https://string-db.org/). Search for the Shiga toxin-encoding genes in bacteria.

Discussion

Challenge 2.4.1

  • Can you find the Shiga toxin-coding genes in Escherichia coli K-12?
  • Do you find the same strain as above?
Challenge

Challenge 2.4.2

Can you tell on what chromosomal feature these genes are located?

What genes are located next to these genes?

What is a lysogenic phage?

Feel free to explore the different functions of the database. What do the different links in the network mean? What happens if you remove the least reliable interaction sources (i.e. text mining and databases?

Now modify the settings to keep only Neighborhood as edges. Go back to the Viewers tab. Search for the other gene discussed above, tufA, do the same as for stx1, and compare the results.

Discussion

Challenge 2.4.3

  • How many genes are co-localized with stx1?
  • What are the functions of these?
Discussion

Challenge 2.4.4

  • How many genes are co-localized with tufA?
  • What are the functions of the gene?
  • Does the function correlate with the taxonomic breadth of the gene?

For both genes, select the Neighborhood viewer.

Discussion

Challenge 2.4.5

  • How taxonomically widespread are the stx1, respectively tufA genes?
  • How conserved is the gene order for these two genes?
Key Points
  • NCBI website is very, very comprehensive
  • The Entrez cross-referencing system helps retrieving links bits of data of different type.

Content from BLAST


Last updated on 2026-04-01 | Edit this page

Overview

Questions

  • How to use the command-line version of BLAST?

Objectives

  • Run different flavors of BLAST
  • Use different databases
  • Use profile-based BLAST to retrieve distant homologs

Introduction


The goal of this exercise is to practice with the command line-based version of BLAST. It is also the first step in building phylogenetic trees, namely by gathering homologous sequences that will then be aligned. The alignment is finally used to build a tree.

The whole exercise is based on RpoB, the β-subunit of the bacterial RNA polymerase. This protein is essential to the cell, and present in all bacteria and plastids. It is also very conserved, and thus suitable for deep-scale phylogenies.

BLAST

BLAST (basic local alignment search tool, also referred to as the Google of biological research) is one of the most widely used tools in bioinformatics. The wide majority of its uses can be performed online, but for larger searches, batches or advanced uses, the command line version, performed locally on a computer or cluster, is indispensable.

Resources at UPPMAX

BLAST is available at UPPMAX. To load the BLAST+ module, as it is knonw in Pelle, use the module load command. In the same command, also load the BLAST_databases module, to be able to use the standard databases that NCBI maintains.

BASH

module load BLAST+ BLAST_databases

Databases available at UPPMAX are described here: https://docs.uppmax.uu.se/databases/blast/. The BLAST_databases module implies that you don’t need to specify where the databases are located on the file system. In detail, it sets the BLASTDB variable to the right folder. You can see it by typing echo $BLASTDB in the terminal.

Gene and protein records are usually associated with a taxid, to describe what organisms they come from. This can be very useful to limit the search to a certain taxon, or to exclude another taxon. E.g. if you want to investigate whether a certain gene has been transferred from bacteria to archaea: you would search for that specific by excluding all bacteria and eukaryotes.

Taxonomy resources at UPPMAX are described here: https://docs.uppmax.uu.se/databases/ncbi/

Exercise 0: Login to Uppmax


This is just a reminder of the introduction to Linux and how to login to Uppmax.

Challenge

Challenge 0.1

Login to Uppmax and navigate to the course folder, create a folder for a blast exercise.

Remember the best practices you learned for file naming.

All exercises should be performed inside /proj/g2020004/nobackup/3MK013/<username> where <username> is your own folder.

ssh is used to connect to an external server. -Y forwards the graphical display to your computer. The address of the server is pelle.uppmax.uu.se. You need to add your user name in front of it, with a @ in between.

The course folder is at /proj/g2020004/nobackup/3MK013/.

There, make a folder with your username.

Inside it, create a blast folder for this exercise.

Challenge

Challenge 0.2

Access an interactive session that is booked for us. The session is uppmax2026-1-93. Use the pelle cluster, for 4 hours.

BASH

interactive -A <project> -M <cluster> -t <hh:mm:ss> 

Exercise 1: Finding and retrieving homologs


Here, you will first find the protein query to start your search with. You will test different methods to create a file containing only RpoB from E. coli. Then, you will use that file as a query to find homologs of RpoB in different databases.

Task 1.1: Retrieve the RpoB sequence for E. coli

First, use your recently acquired NCBI-fu to retrieve the sequence from E. coli K-12. There are many genomes, and thus many identical proteins, grouped into Identical Protein Groups. NCBI’s databases are (almost) non-redundant (that’s where the name of the largest protein database, nr comes from), and thus only one representative per IPG is present. Thus search in IPG, and find the IPG’s accession number. Write down the accession number somewhere.

Challenge

Challenge 1.1.1: Finding E. coli’s RpoB

Find the accession number for the IPG containing the RpoB sequence of E. coli K-12, and download the sequence in FASTA format.

The accession number is WP_000263098.1.

The sequence in fasta format can be downloaded at https://www.ncbi.nlm.nih.gov/protein/ by searching the accession number clicking on the “Send to” link and then choosing FASTA format. Save the file under rpoB_ecoli.fasta.

The fasta file should look like:

>WP_000263098.1 MULTISPECIES: DNA-directed RNA polymerase subunit beta [Enterobacteriaceae]
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQY
VSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVING

Task 1.2: Push the sequence to UPPMAX

The sequence is located on your computer, and you need to transfer it to your computer. You will test several methods to push it to UPPMAX, to be able to use it as a query for BLAST.

Challenge

Challenge 1.2.1: Use scp

scp, secure file copy, is a tool to copy files via SSH, the same protocol you use to login to UPPMAX. You can use it on your computer with the following syntax:

BASH

scp <file to copy> <username>@<server>:<remote file location>

The remote file location can be a relative path from your home or an absolute path, starting with /.

To bring up a local terminal on your Windows computer, click on the “+” sign on the main window of MobaXTerm. If that doesn’t work, use SFTP. Click on Session, SFTP, and fill in the Remote host as usual pelle.uppmax.uu.se and your username. Navigate to /proj/g2020004/nobackup/3MK013/<username>/blast on the right panel, then drag and drop files between your computer and Uppmax.

Use man scp to show the manual for scp.

Challenge

Challenge 1.2.2: Use copy/paste

A quick and dirty method is to open a graphical text editor on the remote server and paste the information in it. One such tool is nedit. Paste the content of the file into nedit and save it in the appropriate folder, under rpoB_ecoli.fasta.

On UPPMAX

BASH

module load NEdit
cd /proj/g2020004/nobackup/3MK013/<username>/blast
nedit rpoB_ecoli.fasta &

The & executes the program in the background, leaving you control of the command line.

Challenge

Challenge 1.2.3: Extract sequence from database

Since you know the accession number of the sequence to be used as a query, you can use the blast tools to extract that specific sequence from one of the databases available at UPPMAX. The tool in question is blastdbcmd. That specific sequence is presumably present in multiple databases. In doubt, one could search nr. But since E. coli K-12 is present in the tiny landmark database, you can use that one.

Put the sequence, in FASTA format, into a file called rpoB_ecoli.fasta

The manual for blastdbcmd can be obtained with:

BASH

blastdbcmd -help

If you have closed your session, you may need to use module load to load the appropriate module.

You may want to look into -db and -entry arguments.

BASH

blastdbcmd -db <db name> -entry <accession> > <file>

You should use the -db option and the -entry one.

Challenge

Challenge 1.2.4 (optional): Size of databases

Can you figure out a way to find the size of these two databases? How does it affect the time to retrieve information from them? Is it worth thinking about it?

You can look at the size of the databases by using blastdbcmd and the flag -info. To see how much time it takes to retrieve that single sequence from either database, use the command time in front of the command:

BASH

blastdbcmd -db <db> -info

time blastdbcmd -db <db> -entry <accession> > /dev/null

OUTPUT

Database: Landmark database for SmartBLAST
	506,514 sequences; 311,806,943 total residues

Date: Aug 6, 2025  4:19 AM	Longest sequence: 35,991 residues

[...]

Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects
	1,008,714,371 sequences; 383,393,166,825 total residues

Date: Feb 24, 2026  4:54 AM	Longest sequence: 98,182 residues

[...]
real	0m0.417s     # for landmark
[...]
real	0m5.418s     # for nr

Task 1.3: Finding homologs to RpoB with BLAST

Now we have a query to start our search. Check that the file is present (ls) and that it looks like a FASTA file (less).

OUTPUT

>WP_000263098.1 unnamed protein product [Escherichia coli] >NP_312937.1 RNA polymerase beta subunit [Escherichia coli O157:H7 str. Sakai]
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVF
[...]

The file header might look slightly different, depending on how you obtained it. Now use blastp to find homologs of the RpoB protein. Use the help for blastp to explore the options you need to set.

Challenge

Challenge 1.3.1: Use blastp to find homologs in the landmark database

The path to the databases is already set correctly by the modules load blast command. See echo $BLASTDB to display it. Put the results into a file called rpoB_landmark.blast

Use the following command to find options. Explore -database

BASH

blastp -help

BASH

blastp -db <db> -query <fasta file> > <output file>

Explore the results of the blastp command by displaying the file in which you put the output of blastp. Inspect the alignments, including those at the bottom of file, which have worse alignments. In particular look at the E-values: do all hits look like true homologs? How can you change that?

Challenge

Challenge 1.3.2: Use blastp to find better homologs

Find the right option to change the E-value threshold to include hits. What is the default E-value? What does that mean?

Try to rerun the blastp search with a more reasonable value than the default.

As a rule of thumb, hits that have a E-value < 1e-6 are bona fide homologs. Look at the -evalue option.

BASH

blastp -db <db> -query <fasta_file> -evalue <evalue> > output

Explore the results again. Is it better, even the last alignments?

The default format of the blast output is “human-friendly”, something that resembles the output that is created on the NCBI website. To produce an output that is even closer to NCBI’s output, use the -html option.

The default format is fine for visual inspection, but not very convenient for computers to read. For example, in some cases you might want to perform data analysis on the output, e.g. to sort the results further or to compare the output of different runs. In that case, a tabular-like output is to prefer. The main option is -outfmt, and setting it to 6 will produce such a tabular output. The columns can be further specified, see the manual.

Challenge

Challenge 1.3.3: Explore the output format of BLAST

Play with the different options for outfmt, the different formats and how to customize the tabular formats (6, 7 and 10).

Finally, produce a standard tabular output for the same run as above and put the result into a file called rpoB_landmark.tab. This file can then downloaded to your own computer and opened with R or with Excel.

Note that the query sometimes yields several hits in the same query protein. This is caused by the protein being long and having its different domains being separated by less conserved domains.

blastp command:

BASH

blastp -db <db> -query <fasta file> -evalue <e-value> -outfmt <number> > <output_file>

To import the file to your computer, to the current directory, use the same scp program as above. This should be run on your own computer, not from UPPMAX.

BASH

scp <username>@pelle.uppmax.uu.se:<course base folder>/3MK013/<username>/blast/<file> .

Task 1.4: Use a larger database

So far you have used the landmark database, which is tiny. Now, use a different, larger database, to gather more results from a broader set of bacteria. Run a blastp again. How many significant hits do you find in these?

Challenge

Challenge 1.4.1: Larger database

refseq_select_prot and refseq_protein are good candidates. The former is smaller than the latter. Note that these two runs will take time, so run only the one to refseq_select_prot. We will run it in the background (adding a & at the end of the command) so that you can continue with other tasks and come back to that one later.

You can check whether blastp is still running by typing ps:

BASH

ps

OUTPUT

  PID TTY          TIME CMD
13920 pts/64   00:00:00 bash
33117 pts/64   00:00:00 blastp
35427 pts/64   00:00:00 ps

If you see blastp there, it means it is still running. It could take up to 30 minutes. When blastp is done, count the number of hits obtained.

The list of locally available databases is listed here: https://docs.uppmax.uu.se/databases/blast/

BASH

blastp -db <db> -query <fasta file> -evalue <e-value> -outfmt 6 > rpoB_<db>.tab &

When it has finished (it may take up to 30 minutes), count the rows to have the number of hits:

BASH

wc -l rpoB_<db>.tab

OUTPUT

500 rpoB_refseq_select.tab

You have actually hit the maximum number of aligned sequences to keep by default (500). You could change that by using the -max_target_seqs option and setting it to a larger number.

Task 1.5: Extract the sequences from the database

You found hits, i.e. proteins that show similarity with the query protein. To prepare for the next steps (multiple sequence alignment and building trees), you will need to retrieve the actual proteins and put them in a FASTA file. The simplest way is to directly extract them from the database, using the same tool (blastdbcmd) as above. You will first need to extract a list of the accession numbers from the blast results.

Challenge

Challenge 1.5.1: Extract the sequences with blastdbcmd

Use blastdbcmd to retrieve the accession ids from the landmark database. To prepare the list of proteins to extract, cut the blast results to keep the accession number of the hits. As you noticed above, there are multiple hits per protein and one hit per line, resulting in each subject protein being possibly present several times. You will need to produce a non-redundant list of ids.

BASH

blastdbcmd -help
man uniq
man sort

The second column of the default tabular output provides the accession id. cut the tabular output of the blast file, pipe it to sort and then to uniq, and send the result in a file. Then use that file as a input to blastcmd to extract the proteins. Last time we used -entry because we had just one, but there is another argument that takes a list of entries instead. Put the result in the rpoB_homologs.fasta file.

BASH

cut -f2 <blast_output_file> | sort | uniq > <id_file> 
blastdbcmd -db <db> -entry_batch <id_file> > rpoB_homologs.fasta
Challenge

Challenge 1.5.2: Count the sequences

Can you count how many sequences were included in the fasta file? Use grep and your knowledge of the FASTA format.

BASH

man grep
man wc

You can take a look at the sequences that were included in the blast:

BASH

grep ">" <fasta_file> | less

And then count them by piping the result to wc instead.

There should be around 80 sequences.

OUTPUT

80

For the upcoming episode on multiple sequence alignment, you will use a subset of these.

Exercise 2: Using PSI-BLAST to retrieve distant homologs of proteins


In this exercise, you will use another flavor of BLAST to retrieve distant homologs of a protein. As an example, we will use the protein RavC, present in the genomes of Legionella bacteria. This protein is an effector protein, injected by Legionella into the cytoplasm of their host (protists). The exact function is unknown, but it is presumably important, as it is conserved throughout the whole order Legionellales. Many effectors found in this group are derived from eukaryotic proteins, and this is what you will test here: does RavC have a homolog in eukarotes?

The strategy is to use psiblast, which uses - instead of a single query - a matrix of amino-acid frequencies as a query. psiblast is an iterative program: you generally start with one sequence, gather bona fide homologs, use the profile of these to query the database again, gather new homologs, recalculate the profile, then re-query the database, etc. The search may converge after a certain number of iterations, i.e. there no more new homologs to find with the latest profile.

In this case, you will use a slightly different strategy: you will start with one sequence, align it to refseq_select_prot but only to sequences in the order Legionellales, using the taxids options that limits the taxonomic scope of the search. You will save the profile (PSSM) generated by the first psiblast round and reuse this to then query the whole database, with three iterations.

Task 2.1: Extract RavC from a database

As above, you will extract the sequence of RavC from a database. This time you will use refseq_select_prot, since there are no Legionella in landmark. The accession number of RavC that you will use is WP_010945868.1.

Challenge

Challenge 2.1.1: Extract RavC

Retrieve sequence WP_010945868.1 from the refseq_protein database and put it into a file called ravC_LP.fasta. Check the content of the FASTA file.

blastdbcmd -help

BASH

blastdbcmd -db <db> -entry <accession> > <output_file>

OUTPUT

>WP_010945868.1 RMD1 family protein [Legionella pneumophila]
MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNKDHTLFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDK
PVALLVHDEFHYQIGDKTAIEPHGFYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGE
MPISRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAINHRLDTLNEIFDMFNGYLE
SRHGHHLEIIIIVLIAVEIIIAVMNFHF

Task 2.2: Align RavC to sequences belonging to Legionellales

That task is a bit complex, so let’s break it down in several steps. Let’s build and use a PSSM matrix, the amino-acid profile built by psiblast. The matrix is a way to represent a multiple-sequence alignment in a statistical way. In brief, each column (or position) of the alignment is represented by a vector of the probabilities to find each nucleotide (or amino-acid) at that position.

You will:

  1. align the RavC sequence to the refseq_select_prot database, using psiblast, and put the result into the file ravC_Leg.psiblast.
  2. save the PSSM matrix after the last round, both in its “native” form and in text format.
  3. filter hits so that only hits with E-value < 1e-6 are shown
  4. filter hits so that only hits with E-value < 1e-10 are included in the PSSM
  5. filter hits so that only hits belonging to the order Legionelalles are included
Challenge

Challenge 2.2.1: Psiblast

Build the command, using the psiblast command, the query you extracted above and the refseq_select_prot database.

Caution

Don’t run the command yet, as this will run for a while! We are just building the command now. Wait for the end of the section.

BASH

psiblast -help

That is the base of the command:

BASH

psiblast -query <fasta file> -db <db> > ravC_Leg.psiblast
Challenge

Challenge 2.2.2: Saving the PSSM

Now add the options to save the PSSM after the last round, and save the PSSM both as binary and ascii form. Add these options to the command above, but you will only run it when it is finished.

In the PSI-blast help there is a “PSI-BLAST options” section.

For long help pages, it is sometimes useful to pipe the help message to grep and use a combination of -A (after), -B (before), and --color (color matches).

BASH

psiblast -help
psiblast -help | grep --color -B 5 -A 2 pssm

BASH

psiblast -query <fasta_file> -db <db> -save_pssm_after_last_round -out_pssm <pssm_file> -out_ascii_pssm <pssm_file.txt> > ravC_Leg.psiblast
Challenge

Challenge 2.2.3: Thresholds

Now add the E-value thresholds. You want to display hits with E-value < 1e-6, but only include those with E-value < 1e-10. Add the options to the rest.

BASH

psiblast -query <fasta_file> -db <db> -save_pssm_after_last_round -out_pssm <pssm_file> -out_ascii_pssm <pssm_file.txt> -inclusion_ethresh <evalue> -evalue <evalue> > ravC_Leg.psiblast
Challenge

Challenge 2.2.4: Taxonomic range

Now limit the results to the order Legionellales. Find the taxid of this group on the NCBI website.

Note: this feature has been upgraded in the latest version of BLAST (2.15.0+). It is now possible to include all descendants of a single taxid, using only that taxid. In previous versions of BLAST, you had to include all descending taxids using a script.

Check out the Taxonomy section of NCBI: https://www.ncbi.nlm.nih.gov/Taxonomy/

https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?mode=Info&id=118969&lvl=3&lin=f&keep=1&srchmode=1&unlock

BASH

psiblast -query <fasta_file> -db <db> -save_pssm_after_last_round -out_pssm <pssm_file> -out_ascii_pssm <pssm_file.txt> -inclusion_ethresh <evalue> -evalue <evalue> -taxids <taxid> > ravC_Leg.psiblast
Discussion

Challenge 2.2.5: Running the command and examining the results

Run now the full command as above. When it’s done, look at the resulting files. There should be three of them. Take some time to explore these three files, especially the alignments resulting from the psiblast.

Task 2.3: Align the PSSM to the whole database

You will now take the resulting PSSM and use that as a query to perform a psiblast against the whole refseq_select_prot database (not only against Legionellales). You want to perform max 10 iterations (the search will stop if it converges before the tenth iteration), and increase the max number of target sequences to gather to 1000 per iteration. You also want to change the output to a tabular form with comments and add more columns to get into more details.

Challenge

Challenge 2.3.1: Align the PSSM, set E-value thresholds, iteration and max sequences

Build the command as above, but don’t set the -query option, use the option that allows to input a PSSM instead. Set the E-value thresholds as above, the number of iterations to 10 and the maximum number of sequences to gather to 1000 (per round). Direct the result to the file ravC_all.psiblast.

Don’t run it yet, more options to come.

BASH

psiblast -help
psiblast -help | grep --color -B 5 -A 2 pssm

BASH

psiblast -in_pssm <binary pssm file> -db <db> -inclusion_ethresh <evalue> -evalue <evalue> -max_target_seqs <number> -num_iterations 10 > ravC_all.psiblast
Challenge

Challenge 2.3.2: Set the output format

You want to have a tabular result format with comments, to help you understand the output. You also want to use the standard columns but add the query coverage per subject, the scientific and common name of the subject sequence, as well as which super-kingdom (or domain) it belongs to.

Inspect the “Formatting options” section of the psiblast help page.

The correct -outfmt is 7. The string with the correct columns is composed with this number and then column names, separated by spaces, the whole enclosed by double quotes. An example in the help file of psiblast is "10 delim=@ qacc sacc score"

BASH

psiblast -in_pssm <binary pssm file> -db <db> -inclusion_ethresh <evalue> -evalue <evalue> -max_target_seqs <number> -num_iterations 10 -outfmt "<format_number> <col1> <col2> ..." > ravC_all.psiblast
Discussion

Challenge 2.3.3: Run the command and examine the results

This will take a while to run, maybe 30 minutes. When done, open the result file and examine it. Did you find hits in the eukaryotes?

Getting impatient? You can examine an already-made file obtained with the same command. It is available at:

BASH

ls /proj/g2020004/private/3MK013/lionel/blast/ravC_all.psiblast
Key Points
  • Using BLAST is a blast!
  • Choice of database is a crucial trade-off between efficiency and sensitivity

Content from Multiple sequence alignment and phylogenetics


Last updated on 2026-04-01 | Edit this page

Part 1: Multiple Sequence Alignment (MSA)

Overview

Questions

  • How do you align multiple sequences?
  • Why is it important to properly align sequences?

Objectives

  • Use mafft to align multiple sequences.
  • Test different algorithms.

Introduction

In this episode, we are exploring multiple sequence alignment (MSA). In the first task, you are going to use mafft to align homologs of RpoB, the β subunit of the bacterial RNA polymerase. It is a long, multi-domain protein, suitable for showing issues related to MSA.

In the second task, you will trim that alignment to remove poorly aligned regions.

But first, go to your own folder and create a phylogenetics subfolder. You will use the alignments for other tutorials as well.

Task 1: Use different flavors of MAFFT and compare the results

Start by finding the data, which is a fasta file containing 19 sequences of RpoB, gathered by aligning RpoB from E. coli to a very small database present at NCBI, the landmark database. These sequences are a subset of the sequences gathered in the previous exercise on BLAST.

The file is available in /proj/g2020004/nobackup/3MK013/data/.

Challenge

Challenge 1.1: prepare the terrain

The course base folder is at /proj/g2020004/nobackup/3MK013. Go to your own folder, create a phylogenetics subfolder, and move into it. Also, start the interactive session, for 4 hours. The session name is uppmax2026-1-93 and the cluster is pelle.

Remember those commands?

BASH

ssh -Y
cd
mkdir
ls
interactive

BASH

ssh -Y <username>@pelle.uppmax.uu.se

Remember to replace <username> by your name.

BASH

interactive -A <session> -M <cluster> -t <hh::mm::ss>
cd <basefolder>/<username>
mkdir <folder>
cd <folder>
Challenge

Challenge 1.2: copy the file

Copy the file to your newly created phylogenetics folder. Use a relative path.

BASH

cp
pwd
ls ../..

Use the ../../ to see what’s two folders up, and then data/rpoB/rpoB.fasta

Renaming sequences

Look at the accession ids of the fasta sequences: they are not very informative.

BASH

grep '>' rpoB.fasta | head -n 5

OUTPUT

>WP_000263098.1 MULTISPECIES: DNA-directed RNA polymerase subunit beta [Enterobacteriaceae]
>WP_011070610.1 DNA-directed RNA polymerase subunit beta [Shewanella oneidensis]
>WP_003114335.1 DNA-directed RNA polymerase subunit beta [Pseudomonas aeruginosa]
>WP_002228870.1 DNA-directed RNA polymerase subunit beta [Neisseria meningitidis]
>WP_003436174.1 MULTISPECIES: DNA-directed RNA polymerase subunit beta [Eubacteriales]

Keep the taxonomic name following the accession id, separated by _, using a bit of sed magic. Save the resulting file for later use, and show the headers again.

BASH

sed "/^>/ s/>\([^ ]*\) \([^\[]*\)\[\(.*\)\]/>\\3_\\1/"  rpoB.fasta | sed "s/ /_/g" > rpoB_renamed.fasta
grep '>' rpoB_renamed.fasta | head -n 5
Discussion

Nerd alert: dissecting the sed magic

This is optional reading.

The sed command matches (and possibly substitutes) strings (chains of characters). In that case, the goal is to simplify the header by putting the taxonomic group first but keeping it informative enough by adding the accession number. The strategy is to match what is between the > and the first space, then what is between square parentheses, and put them back, separated by an underscore.

The sed command first matches only lines that start with a > (/^>/). It then substitutes (general pattern s/<something>/<something else>/) a text with another one. The first part is to match the accession id, between (escaped) square brackets, which comes after the > at the beginning of the line. This is expressed as >\([^ ]*\): match any number of non-space characters ([^ ]*) and put it in memory (what is between \( and \)). Then, the description is matched by \([^\[]*\), any number of characters that are not an opening bracket [, and put into memory. Finally, the taxonomic description is matched: \[\(.*\)\], that is, any number of characters between square brackets is stored into memory. The whole line is then replaced with a >, the third match into memory, followed by an _ and the content of the first match into memory >\\3_\\1. Then, all the input is passed through sed again, to replace any space with an underscore: s/ /_/g and the output is stored in a different file.

OUTPUT

>Enterobacteriaceae_WP_000263098.1
>Shewanella_oneidensis_WP_011070610.1
>Pseudomonas_aeruginosa_WP_003114335.1
>Neisseria_meningitidis_WP_002228870.1
>Eubacteriales_WP_003436174.1

It looks better.

Alignment with progressive algorithm

Use mafft with a progressive algorithm to align the sequences.

Challenge

Challenge 1.3: Run mafft with progressive algorithm

Use the FFT-NS-2 algorithm from mafft to align the renamed sequences. Also, record the time it takes for mafft to complete the task.

Use the module command to load MAFFT. Use time to record the time.

The help obtained through mafft -h is not very informative about algorithms, so check the mafft webpage.

mafft actually has one executable program for each algorithm, all starting with mafft-. A way to display them all is to type that and push the Tab key twice to see all possibilities.

BASH

module load <mafft module>
time mafft-<algorithm> <fasta_file> > rpoB.fftns.aln

OUTPUT

...
[...]
Strategy:
 FFT-NS-2 (Fast but rough)
 Progressive method (guide trees were built 2 times.)

If unsure which option to use, try 'mafft --auto input > output'.
For more information, see 'mafft --help', 'mafft --man' and the mafft page.

The default gap scoring scheme has been changed in version 7.110 (2013 Oct).
It tends to insert more gaps into gap-rich regions than previous versions.
To disable this change, add the --leavegappyregion option.


real	0m1.125s
user	0m0.818s
sys	0m0.181s

The last line is the output of the time command. It took 1.125 seconds to complete this time.

Type mafft and try tab-complete to see all versions of mafft.

Try the command time

Alignment with iterative algorithm

Now use one of the supposedly better iterative algorithm of mafft to align the same sequences. Choose the E-INS-i algorithm which is suited for proteins that have highly conserved motifs interspersed with less conserved ones.

Take a few minutes to read upon the different alignment strategies on the page above.

Challenge

Challenge 1.4

Use the superior E-INS-i algorithm from mafft to align the renamed sequences. Also, record the time it takes for mafft to complete the task.

BASH

time mafft-<better algo> <fasta file> > rpoB.einsi.aln

OUTPUT

[...]
Strategy:
 E-INS-i (Suitable for sequences with long unalignable regions, very slow)
 Iterative refinement method (<16) with LOCAL pairwise alignment with generalized affine gap costs (Altschul 1998)

If unsure which option to use, try 'mafft --auto input > output'.
For more information, see 'mafft --help', 'mafft --man' and the mafft page.

The default gap scoring scheme has been changed in version 7.110 (2013 Oct).
It tends to insert more gaps into gap-rich regions than previous versions.
To disable this change, add the --leavegappyregion option.

Parameters for the E-INS-i option have been changed in version 7.243 (2015 Jun).
To switch to the old parameters, use --oldgenafpair, instead of --genafpair.


real	0m7.367s
user	0m7.022s
sys	0m0.244s

It now took 7.36 seconds to complete this time, i.e. 6 times more than with the progressive algorithm. It doesn’t make a big difference now, but with hundreds of sequences it will make one.

Alignment visualization

You will now inspect the two resulting alignment methods. There are no convenient way to do that from Uppmax, and the easiest solution is to download the alignments on your computer and to use either seaview (you will need to install it on your computer) or an online alignment viewer like AlignmentViewer.

Arrange the two windows on top of each other. Change the fontsize (Props -> Fontsize in Seaview) to 8 to see a larger portion of the alignment.

Challenge

Challenge

Can you spot differences? Which alignment is longer?

Hint: try to scroll to position 800-900. What do you see there? How are the blocks arranged?

Use scp to copy files from Uppmax to your computer. scp allows wildcards, but you probably need to escape the *.

BASH

scp <username>@pelle.uppmax.uu.se:/<absolute path to phylogenetics folder>/rpoB.\*.aln <localfolder>/
Alignments shown in seaview

If you have time over, spend it exploring the different options of Seaview/AlignmentViewer.

Task 2: Trim the alignment

Often, some regions of the alignment don’t align properly, either because they contain low complexity segments (hinges in proteins) or evolved through repeated insertions/deletions, which alignment program cannot handle properly. It is thus good practice to remove (trim) these regions, as they are likely to worsen the quality of the subsequent phylogenetic trees. On the other hand, trimming too much of the alignment removes also potentially valuable information. There is thus a balance to be found.

In this part, you will use two different alignment trimmers, TrimAl and ClipKIT, on the results of mafft’s E-INS-i algorithm.

Trimming with TrimAl

First, load the module and look at the list of options available with trimAl.

BASH

module load trimAl
trimal -h

trimAl offers a lot of different options. You are going to explore two different: gap threshold (-gt) and the heuristic method -automated1, which automatically decides between three automated methods, -gappyout, -strict and -strictplus, based on the properties of the alignment. The gap threshold methods removes columns that contain a fraction of sequences lower than the cut-off.

For comparison purposes, you will be adding an html output.

Challenge

Challenge 2.1: TrimAl with gap threshold

Use trimAl to remove positions in the alignment that have more than 40% gaps.

The “gap threshold” is actually expressed as fraction of non-gap residues.

BASH

trimal -in <input aln> -out rpoB.einsi.trimalgt.aln -gt <cut-off> -htmlout <html_output>
Challenge

Challenge 2.2: TrimAl with automated trimming

Use trimAl with the automated heuristic algorithm.

Add a -automated1 option and rerun as above, choosing a different output file.

Challenge

Challenge 2.3: Compare the results

Get the files (both alignments and html files) to your own laptop and visualize the results, by opening the html files with your browser and the alignment files with seaview or the viewer you used above.

On your own laptop, go inside the folder where you want to import the files. Use scp. On some OS it is necessary to escape the wildcard *. If the output says something about no matches found, try that.

As before, if you do not have access to a terminal on your windows laptop, use MobaXterm and Session > SFTP to copy files to your computer.

Trimming with ClipKIT

ClipKIT is one of the more recent tools to trim multiple sequence alignments. In a nutshell, it tries to preseve phylogenetically-informative sites, rather than trimming gappy regions. Although it also has multiple options and modes, you will only use the default mode, smart-gap.

Challenge

Challenge 2.4: Use ClipKIT

To get an idea of the modes and options, load the ClipKIT module and look at the help page:

BASH

module load ClipKIT
clipkit -h

Then run ClipKIT, explicitly using the smart-gap mode. Compare how much ClipKIT has trimmed the original alignment compared to trimAl.

BASH

module load ClipKIT
clipkit -h

BASH

clipkit <input aln> -m <mode> -l -o <output file>

OUTPUT

---------------------
| Output Statistics |
---------------------
Original length: 2043
Number of sites kept: 1543
Number of sites trimmed: 500
Percentage of alignment trimmed: 24.474%

Execution time: 0.379s

Comparing all the results

Import the data and inspect the three alignments.

Challenge

Challenge 2.5: Import data and compare results

Copy the alignment file and visualize with seaview or the web-based visualization tool.

Use scp as above.

Then use seaview or another viewer to visualize and compare results.

The three alignments on top of each other look like this. Click on this link to better see the figure.

Alignments shown in seaview

It is of course difficult to draw conclusions based on this figure, but can you spot some trends? What alignment is more likely to generate good results?

Part 2: Phylogenetics

Overview

Questions

  • How do you build a simple, distance-based phylogenetic tree?
  • How do you build a phylogenetic tree with more advanced methods?
  • How do you ascertain statistical support for phylogenetic trees?

Objectives

  • Use mafft to align multiple sequences.
  • Test different algorithms.

Overview

Questions

  • How do you build a simple, distance-based phylogenetic tree?
  • How do you build a phylogenetic tree with more advanced methods?
  • How do you ascertain statistical support for phylogenetic trees?

Objectives

  • Learn the basic of phylogenetics tree building, taking the simplest of the examples with a UPGMA tree.
  • Learn how to use phylogenetics algorithms, neighbor-joining and maximum-likelihood.
  • Learn how to perform and show bootstraps.

Task 3: Paper-and-pen phylogenetic tree

Setup

The exercise is done for a large part with pen and paper, and then a demonstration in R on your laptop, using RStudio. We’ll also use the R package ape, which you should install if it’s not present on your setup. Commands can be typed or pasted in the “Console” part of RStudio.

R

install.packages('ape')

OUTPUT

- Querying repositories for available source packages ... Done!
The following package(s) will be installed:
- ape [5.8-1]
These packages will be installed into "~/work/course-microbial-genomics/course-microbial-genomics/renv/profiles/lesson-requirements/renv/library/linux-ubuntu-jammy/R-4.5/x86_64-pc-linux-gnu".

# Installing packages --------------------------------------------------------
[32m✔[0m ape 5.8-1                                [linked from cache]
Successfully installed 1 package in 3.2 milliseconds.

And to load it:

R

library(ape)

UPGMA-based tree

Load the tree in fasta format, reading from a temp file

R

FASTAfile <- tempfile("aln", fileext = ".fasta")
cat(">A", "----ATCCGCTGATCGGCTG----",
    ">B", "GCTGATCCGTTGATCGG-------",
    ">C", "----ATCTGCTCATCGGCT-----",
    ">D", "----ATTCGCTGAACTGCTGGCTG",
    file = FASTAfile, sep = "\n")
aln <- read.dna(FASTAfile, format = "fasta")

Now look at the alignment. Notice there are gaps, which we don’t want in this example. We also remove the non-informative (identical) columns.

R

alview(aln)

OUTPUT

  000000000111111111122222
  123456789012345678901234
A ----ATCCGCTGATCGGCTG----
B GCTG.....T.......---....
C .......T...C.......-....
D ......T......A.T....GCTG

R

aln_filtered <- aln[,c(7,8,10,12,14,16)]
alview(aln_filtered)

OUTPUT

  123456
A CCCGTG
B ..T...
C .T.C..
D T...AT

Now we have a simple alignment as in the lecture. Dots (.) mean that the sequence is identical to the top row, which makes it easier to calculate distances.

Challenge

Calculating distance “by hand”

Let’s use a matrix to calculate distances between sequences. We’ll just count the number of differences between the sequences. We’ll then group the two closest sequences. Which are they?

Distances between the sequences.
A B C D
A
B
C
D

Here is the solution:

Distances between the sequences.
A B C D
A
B 1
C 2 3
D 3 4 5

The two closest sequences are A and B.

Challenge

Calculating distance “by hand” (continued)

Let’s now cluster together A and B, and calculate the average distance from AB to the other sequences, weighted by the size of the clusters.

Recalculated distances.
AB C D
AB
C
D

The average distance for AB to C is calculated as follow:

\(d(AB,C) = \dfrac{d(A,C) + d(B,C)}{2} = \dfrac{2 + 3}{2} = 2.5\)

And so on for the other distances:

Recalculated distances.
AB C D
AB
C 2.5
D 3.5 5
Challenge

Calculating distance “by hand” (continued)

Now the shortest distance is AB to C. Let’s recalculate the distance to D again.

Recalculated distances.
ABC D
ABC
D

\(d(ABC,D) = \dfrac{d(AB,D) * 2 + d(C,D) * 1}{2 + 1} = \dfrac{3.5 * 2 + 5 * 1}{3} = 4\)

Recalculated distances.
ABC D
ABC
D 4

The tree is reconstructed by dividing the distances equally between the two leaves. - A-B: each 0.5. - AB-C: each side gets 2.5/2 = 1.25. The branch to AB is 1.25 - 0.5 = 0.75 - ABC-D: each side gets 4/2 = 2. The branch to ABC is 2 - 0.75 - 0.5 = 0.75

Manually built UPGMA tree
UPGMA tree

Let’s know do the same using bioinformatics tools.

Challenge

Challenge

We’ll use dist.dna to calculate the distances. We’ll use a “N” model, that just counts the differences and doesn’t correct or normalizes. We’ll use the function hclust to perform the UPGMA method calculation. The tree is then plotted, and the branch lengths plotted with edgelabels:

R

dist_matrix <- dist.dna(aln_filtered, model="N")
dist_matrix

OUTPUT

  A B C
B 1
C 2 3
D 3 4 5

R

tree <- as.phylo(hclust(dist_matrix, "average"))
plot(tree)
edgelabels(tree$edge.length)

Task 4: Neighbor-joining and Maximum-likelihood tree

Introduction

In the previous episode, we inferred a simple phylogenetic tree using UPGMA, without correcting the distance matrix for multiple substitutions. UPGMA has many shortcomings, and gets worse as distance increases. Here we’ll test Neighbor-Joining, which is also a distance-based, and a maximum-likelihood based approach with IQ-TREE.

Neighbor-joining

The principle of Neighbor-joining method (NJ) is to start from a star-like tree, find the two branches that, if joined, minimize the total tree length, join then, and repeat with the joined branches and the rest of the branches.

Challenge

Challenge

To perform NJ on our sequences, we’ll use the function inbuilt in Seaview. First (re-)open the alignment we obtained from mafft with the E-INS-i method, trimmed with ClipKIT. If it is not on your computer anymore, transfer it again from Uppmax using scp or SFTP.

If Seaview is not installed on your computer, download it and install it on your computer.

On a Linux computer, you can run it on the command line:

BASH

seaview rpoB.einsi.clipkit.aln &

On other computers, just open the file with the regular File > Open menu.

Discussion

Challenge (continued)

In the Seaview window, select Trees -> Distance methods. Keep the BioNJ option ticked. BioNJ is an updated version of NJ, more accurate for longer distances. Tick the “Bootstrap” option and leave it at 100. We’ll discuss these later. Then click on “Go”.

What do you see? Is the tree rooted? Is the pattern species coherent with what you know of the tree of life? Any weird results?

Challenge

Challenge

Redo the BioNJ tree for the other alignment we inferred.

BASH

seaview rpoB.fftns.aln &

Do you see any differences between the two trees? What can you make out of it?

Maximum likelihood

We will now use IQ-TREE to infer a maximum-likelihood (ML) tree of the RpoB dataset we aligned with mafft previously. While you performed the first trees on your laptop, you will infer the ML tree on Uppmax. As usual, use the interactive command to gain access to compute time. Go to the phylogenetics folder created in the MSA episode, and load the right modules.

Challenge

Challenge

Get to the right folder, require compute time and load the right modules. The project is uppmax2026-1-93. The module containing IQ tree is called IQ-TREE.

BASH

interactive ...
module load ...

BASH

interactive -A <project> -M <cluster> -t <time>
module load IQ-TREE

Then run your first tree, on the ClipKIT-trimmed alignment.

BASH

iqtree -s rpoB.einsi.clipkit.aln -m MFP -B 1000

Here, we tell IQ-TREE to use the alignment -s rpoB.einsi.clipkit.aln, and to test among the standard substitution models which one fits best (-m MFP). We also tell IQ-TREE to perform 1000 ultra-fast bootstraps (-B 1000). We’ll discuss these later.

IQ-TREE is a very complete program that can do a large variety of phylogenetic analysis. To get a flavor of what it’s capable of, look at its extensive documentation.

Have a look at the output files:

BASH

ls rpoB.einsi.clipkit.aln.*

OUTPUT

rpoB.einsi.clipkit.aln.bionj    rpoB.einsi.clipkit.aln.iqtree  rpoB.einsi.clipkit.aln.model.gz
rpoB.einsi.clipkit.aln.ckp.gz   rpoB.einsi.clipkit.aln.log     rpoB.einsi.clipkit.aln.splits.nex
rpoB.einsi.clipkit.aln.contree	rpoB.einsi.clipkit.aln.mldist  rpoB.einsi.clipkit.aln.treefile

There are two important files:
* *.iqtree file provides a text summary of the analysis. * *.treefile is the resulting tree in Newick format.

To visualize the tree, open the Beta version of phylo.io. Click on “add a tree” and copy/paste the content of the treefile (use e.g. less or cat to display it) in the box. Make sure the “Newick format” is selected and click on “Done”.

The tree appears as unrooted. It is good practice to start by ordering the nodes and root it. There is no good way to automatically order the branches in phylo.io as of yet, but rerooting can be done by clicking on a branch and selecting “Reroot”. Reroot the tree between archaea and bacteria. Now the tree makes a bit more sense.

Scrutinize the tree. Is it different from the BioNJ tree generated in Seaview? How?

Challenge

Challenge

Redo a ML tree from the other alignment (FFT-NS) we inferred with mafft and display the resulting tree in FigTree.

BASH

iqtree -h

BASH

iqtree -s <alignment file> <option and text for testing model> <option and test for 1000 fast bootstraps> 

Import the tree on your computer and load it with FigTree or with phylo.io

BASH

figtree rpoB.fftns.aln.treefile &

Bootstraps

We have inferred four trees:

  • Two based on the alignment generated from the E-INS-i algorithm (trimmed by ClipKIT), two from the FFT-NS.
  • Two inferred with the BioNJ algorithm and two with the ML algorithm (IQ-Tree)

Along the way, we’ve generated bootstraps for all our trees. Now show them on all four trees.

  • For the Seaview trees, tick the ‘Br support’ box
  • For the trees shown in phylo.io, click on “Settings” > “Branch & Labels” and above the branch, click the drop-down menu and select “Data”.
Challenge

Challenge

Compare all four trees. Do you find any significant differences?

What are Glycine and Arabidopsis? What about Synechocystis and Microcystis?

Search for the accession number of the Glycine RpoB sequence on NCBI. Any hint there?

The two plant RpoB sequences are from chloroplastic genomes, and thus branch together with the cyanobacterial sequences, in some of the phylogenies at least.

Discussion

Challenge (continued)

What about the support values for grouping these two groups? How high are they?

Key Points
  • The simplest of the trees are distance-based.
  • UPGMA works by clustering the two closest leaves and recalculating the distance matrix.
  • Neighbor-joining is distance-based and fast, but not necessarily very accurate
  • Maximum-likelihood is slower, but more accurate

Part 3: Genetic drift

As a practical way to understand genetic drift, let’s play with population size, selection coefficients, number of generations, etc.

Overview

Questions

  • How does random genetic drift influence fixation of alleles?
  • What is the influence of population size?

Objectives

  • Learn the basic of phylogenetics tree building, taking the simplest of the examples with a UPGMA tree.
  • Learn how to use phylogenetics algorithms, neighbor-joining and maximum-likelihood.
  • Learn how to perform and show bootstraps.

Overview

Questions

  • How does random genetic drift influence fixation of alleles?
  • What is the influence of population size?

Objectives

  • Understand how population size influences the probability of fixation of an allele.
  • Understand how slightly deleterious mutations may get fixed in small populations.

Introduction

This exercise is to illustrate the concepts of selection, population size and genetic drift, using simulations. We will use mostly Red Lynx by Reed A. Cartwright.

Another option is to use a web interface to the R learnPopGen package, but the last one is mostly for biallelic genes (and thus not that relevant for bacteria).

Open now the Red Lynx website and get familiar with the different options.

You won’t need the right panel (but feel free to explore). The dominance option in the left panel won’t be used either.

Challenge

Task 6: Genetic Drift without selection

In the first part, you will only play with the number of generations, the initial frequency and the population size.

  • Lower the number of generations to 200.
  • Adjust the population size to 1000.
  • Make sure the intial frequency is set to 50%.
  • Run a few simulations (ca 20).

Did any allele got fixed? What is the range of frequencies after 200 generations?

In my simulations, no allele got fixed, the final allele frequencies range 20-80%

Challenge

Task 6: Genetic Drift without selection (continued)

Now increase the population to 100’000, clear the graph, and repeat the simulations. What’s the range of final frequencies now?

In my simulations, no allele got fixed, and the final allele frequencies range 45-55%

Challenge

Task 6: Genetic Drift without selection (continued)

Now decrease the population to 10 individuals, clear the graph and repeat these simulations. What’s the range of final frequencies now?

In my simulations, one allele got fixed quickly, the latest one was at generation 100.

Challenge

Task 6: Genetic Drift without selection (continued)

What do you conclude here?

It is clear that stochastic (random) variation in allele frequencies strongly affects the probability of fixation of alleles in small populations, not so much in large ones.

Challenge

Task 7: Genetic Drift with selection

So far we’ve only looked at how allele frequencies vary in the absence of selection, that is when the two alleles provide an equal fitness. What’s the influence of random genetic drift when alleles are not neutral?

The selection strength is equivalent to the selection coefficient, i.e. how much higher relative fitness the new allele provides. A selection coefficient of 0.01 means that the organism harboring the new allele has a 1% increased fitness.

  • Increase the number of generations to 1000.
  • Set the selection strength to 0.01 (1%).
  • Set the population size first to 100’000, then to 1000, then to 100.

How long does it take for the allele to get fixed - in average - with the three population sizes?

About the same time, but the trajectories are much smoother with larger populations. In the small population, it happens that the beneficial allele disappears from the population (although not often).

Challenge

Task 8: Fixation of slightly deleterious alleles in very small populations

We’re now simulating what would happen in a very small population (or a population that undergoes very narrow bottlenecks), when a gene mutates. We’ll have a very small population (10 individuals), a selection value of -0.01 (the mutated allele provides a 1% lower fitness), and a 10% initial frequency, which corresponds to one individual getting a mutation:

  • Set the population to 10 individuals.
  • Set generations to 200.
  • Set initial frequency to 10%.
  • Set the selection strength to -0.01.

Run many simulations. What happens?

Most new alleles go extinct quickly. In my simulations, I usually get one of the slightly deleterious mutations fixed after 20 simulations.

That’s it for that part, but feel free to continue playing with the different settings later.

Key Points
  • Random genetic drift has a large influence on the probability of fixation of alleles in small populations, even for non-neutral alleles.
  • Random genetic drift has very little influence of the probability of fixation of alleles in large populations.
  • Slightly deleterious mutations can get fixed into the population through random genetic drift, if the population is small enough and the selective value is not too large.

Content from Reads, QC and trimming


Last updated on 2026-04-01 | Edit this page

This episode starts a series of labs where you will trace an outbreak of Mycobacterium tuberculosis, from downloading the reads to making assumptions about the transmissions between patients.

The first part, here, describes how to retrieve all necessary data from public repositories - the raw sequenced data of our isolates and a reference genome. It also introduces for loops which we will use for the rest of our analysis.

Overview

Questions

  • Trace an outbreak of Mycobacterium, from reads to phylogenetic tree.
  • How can I organize my file system for a new bioinformatics project?
  • How and where can data be downloaded?
  • How can I describe the quality of my data?
  • How can I get rid of sequence data that doesn’t meet my quality standards?

Objectives

  • How do you use genomics and phylogenetics to trace a microbial outbreak?
  • Create a file system for a bioinformatics project.
  • Download files necessary for further analysis.
  • Use ‘for’ loops to automate operations on multiple files
  • Interpret a FastQC plot summarizing per-base quality across all reads.
  • Clean FastQC reads for further analysis.
  • Use for loops to automate operations on multiple files.

Introduction


This part of the course is largely inspired from another tutorial developed by Anita Schürch. We will use (part of) the data described in Bryant et al., 2013.

Background of the data


Epidemiological contact tracing through interviewing of patients can identify potential chains of patients that transmitted an infectious disease to each other. Contact tracing was performed following the stone-in-the-pond principle, which interviews and tests potential contacts in concentric circles around a potential bash case.

Tuberculosis (TB) is an infectious disease caused by Mycobacterium tuberculosis. It mostly affects the lungs. An infection with M. tuberculosis is often asymptomatic (latent infection). Only in about 10% of the cases the latent infection progresses to an active infection during a patients lifetime, which, if untreated, leads to death in about half of the cases. The symptoms of an active TB infection include cough, fever, night sweats, weight loss etc. An active TB infection can spread. Once exposed, people often have latent TB. To identify people with latent TB, a skin test can be applied.

Here we have 7 tuberculosis patients with active TB, that form three separate clusters of potential transmission as determined by epidemiological interviews. Patients were asked if they have been in direct contact with each other, or if they visited the same localities. From all patients, a bacterial isolate was grown, DNA isolated, and whole-genome sequenced on an Illumina sequencer.

The three clusters consist of:

  • Cluster 1
    • Patient A1 (2011) - sample ERR029207
    • Patient A2 (2011) - sample ERR029206
    • Patient A3 (2008) - sample ERR026478
  • Cluster 2
    • Patient B1 (2001) - sample ERR026474
    • Patient B2 (2012) - sample ERR026473
  • Cluster 3
    • Patient C1 (2011) - sample ERR026481
    • Patient C2 (2016) - sample ERR026482

The second goal of this lab is to affirm or dispute the inferred transmissions by comparing the bacterial genomes with each other. We will do that by identifying SNPs between the genomes.

Getting your project started


Project organization is one of the most important parts of a sequencing project, and yet is often overlooked amidst the excitement of getting a first look at new data. Of course, while it’s best to get yourself organized before you even begin your analyses,it’s never too late to start, either.

Genomics projects can quickly accumulate hundreds of files across tens of folders. Every computational analysis you perform over the course of your project is going to create many files, which can especially become a problem when you’ll inevitably want to run some of those analyses again. For instance, you might have made significant headway into your project, but then have to remember the PCR conditions you used to create your sequencing library months prior.

Other questions might arise along the way:

  • What were your best alignment results?
  • Which folder were they in: Analysis1, AnalysisRedone, or AnalysisRedone2?
  • Which quality cutoff did you use?
  • What version of a given program did you implement your analysis in?

In this exercise we will setup a file system for the project we will be working on during this workshop.

Challenge

Challenge

We will start by creating a sub directory that we can use for the rest of the labs. First navigate to your own directory on Uppmax and start an interactive session. Then confirm that you are in the correct directory using the pwd command.

You should see the output:

OUTPUT

/proj/g2020004/nobackup/3MK013/<username>

BASH

interactive ...
cd /proj/g2020004/nobackup/3MK013/<username>
pwd
Challenge

Exercise

Use the mkdir command to make the following directories:

molepi
molepi/docs
molepi/data
molepi/results

BASH

mkdir molepi molepi/docs molepi/data molepi/results

Use ls -R to verify that you have created these directories. The -R option for ls stands for recursive. This option causes ls to return the contents of each subdirectory within the directory iteratively.

BASH

ls -R molepi

You should see the following output:

OUTPUT

molepi/:
data  docs  results

molepi/data:

molepi/docs:

molepi/results: 

Selection of a reference genome


Reference sequences (including many pathogen genomes) are available at NCBI’s refseq database

A reference genome is a genome that was previously sequenced and is closely related to the isolates we would like to analyse. The selection of a closely related reference genome is not trivial and will warrant an analysis in itself. However, for simplicity, here we will work with the M. tuberculosis reference genome H37Rv.

Challenge

Download reference genomes from NCBI

Download the M.tuberculosis reference genome from the NCBI ftp site.

First, we switch to the data subfolder to store all our data

BASH

cd molepi/data 
Challenge

Download reference genomes from NCBI (continued)

The reference genome will be downloaded programmatically from NCBI with wget. wget is a computer program that retrieves content from web servers. Its name derives from World Wide Web and get.

Find the location of the gzipped fna file for that reference genome via NCBI’s genome, by finding the FTP site and copying the link to the *_genomic.fna.gz file and using that as an argument to wget.

BASH

wget -h

Search for Mycobacterium tuberculosis on the Datasets/Genome website. Identify the “reference genome” (at the top), click on the accession number, and find the FTP tab. There is many files, among which GCF_000195955.2_ASM19595v2_genomic.fna.gz. Right-click and copy the link.

Challenge

Download reference genomes from NCBI (continued)

This file is compressed as indicated by the extension of .gz. It means that this file has been compressed using the gzip command.

Extract the file by typing

BASH

gunzip GCF_000195955.2_ASM19595v2_genomic.fna.gz

Make sure that is was extracted

BASH

ls

OUTPUT

GCF_000195955.2_ASM19595v2_genomic.fna

Challenge: What is the size of the genome?

Find out how many nucleotides the genome has. There is a software called SeqKit (and a corresponding module at Uppmax) that can help.

BASH

module load SeqKit
seqkit -h

Get assembly statistics from FASTA and FASTQ files.

The genome has 4’411’532 bp. The stat command of seqkit is helpful.

OUTPUT

file                                    format  type  num_seqs    sum_len    min_len    avg_len    max_len
GCF_000195955.2_ASM19595v2_genomic.fna  FASTA   DNA          1  4,411,532  4,411,532  4,411,532  4,411,532

Loops


Loops are key to productivity improvements through automation as they allow us to execute commands repeatedly. Similar to wildcards and tab completion, using loops also reduces the amount of typing (and typing mistakes). Our next task is to download our data (see the introduction to this episode) from the short read archive (SRA) at the European Nucleotide Archive (ENA). There are many repositories for public data. Some model organisms or fields have specific databases, and there are ones for particular types of data. Two of the most comprehensive are the National Center for Biotechnology Information (NCBI) and European Nucleotide Archive (EMBL-EBI). In this lesson we’re working with the ENA, but the general process is the same for any database.

We can do this one by one but given that each download takes about one to two hours, this could keep us up all night. Instead of downloading one by one we can apply a loop. Let’s see what that looks like and then we’ll discuss what we’re doing with each line of our loop.

BASH

for sample in ERR029207 ERR029206 ERR026478 ERR026474 ERR026473 ERR026481 ERR026482
do
  echo -e "$sample"
  wget --spider ftp://ftp.sra.ebi.ac.uk/vol1/fastq/"${sample:0:6}"/"${sample}"/"${sample}"_*.fastq.gz
done

When the shell sees the keyword for, it knows to repeat a command (or group of commands) once for each item in a list. Each time the loop runs (called an iteration), an item in the list is assigned in sequence to the variable, and the commands inside the loop are executed, before moving on to the next item in the list.

Inside the loop, we call for the variable’s value by putting $ in front of it. The $ tells the shell interpreter to treat the variable as a variable name and substitute its value in its place, rather than treat it as text or an external command.

In this example, the list is seven accession numbers of reads belonging to the genomes we are interested in. Each time the loop iterates, it will assign a sample name to the variable sample and echo (print) the value of the variable. In the second line, it will run the wget command.

The first time through the loop, $sample is ERR029207. The FTP site at EBI is constructed so that fastq files are stored in a vol1/fastq subfolder. Read files are not directly in that subfolder, but grouped in subfolders starting with the six first characters of the accession number (ERR029 in the first case), then in the accession number subfolder. To get to the right place, the file path is constructed with the root path (ftp://ftp.sra.ebi.ac.uk/vol1/fastq/), to which the first 6 characters of the accession number is added through that special variable operation ("${sample:0:6}") to get to the right subfolder. Finally, the correct accession subfolder ("${sample}"), the file name prefix ("${sample}"_*.fastq.gz") and the suffix (_*.fastq.gz) are added. The * ensures that we get reads from both ends.

Use {} to wrap the variable so that .fastq.gz will not be interpreted as part of the variable name. In addition, quoting the shell variables is a good practice AND necessary if your variables have spaces in them.

For the second iteration, $sample becomes ERR029206.

We added a --spider option to wget just for this exercise, to retrieve only the names of the files and not the actual file, to spare some time downloading files. The data is present in the data/fastq subfolder of our group folder:

BASH

ls /proj/g2020004/nobackup/3MK013/data/fastq

OUTPUT

ERR026473_1.fastq.gz  ERR026474_2.fastq.gz  ERR026481_1.fastq.gz  ERR026482_2.fastq.gz	ERR029207_1.fastq.gz
ERR026473_2.fastq.gz  ERR026478_1.fastq.gz  ERR026481_2.fastq.gz  ERR029206_1.fastq.gz	ERR029207_2.fastq.gz
ERR026474_1.fastq.gz  ERR026478_2.fastq.gz  ERR026482_1.fastq.gz  ERR029206_2.fastq.gz

For more, check Bash Pitfalls

Callout

Follow the Prompt

The shell prompt changes from $ to > and back again as we were typing in our loop. The second prompt, >, is different to remind us that we haven’t finished typing a complete command yet. A semicolon, ;, can be used to separate two commands written on a single line.

Callout

Same Symbols, Different Meanings

Here we see > being used a shell prompt, whereas > is also used to redirect output. Similarly, $ is used as a shell prompt, but, as we saw earlier, it is also used to ask the shell to get the value of a variable.

If the shell prints > or $ then it expects you to type something, and the symbol is a prompt.

If you type > or $ yourself, it is an instruction from you that the shell to redirect output or get the value of a variable.

We have called the variable in this loop sample in order to make its purpose clearer to human readers. The shell itself doesn’t care what the variable is called; if we wrote this loop as:

BASH

for x in ERR01 ERR02 ERR03
do
  echo ftp://ftp.sra.ebi.ac.uk/"${x}".fastq.gz
done

or:

BASH

for pizza in ERR01 ERR02 ERR03
do
  echo ftp://ftp.sra.ebi.ac.uk/"${pizza}".fastq.gz
done

it would work exactly the same way. Don’t do this. Programs are only useful if people can understand them, so meaningless names (like x) or misleading names (like pizza) increase the odds that the program won’t do what its readers think it does.

Callout

Multipart commands

The for loop is interpreted as a multipart command. If you press the up arrow on your keyboard to recall the command, it may be shown like so (depends on your bash version):

BASH

for sample in ERR01 ERR02 ERR03; do echo ftp://ftp.sra.ebi.ac.uk/"${sample}".fastq.gz ; done

When you check your history later, it will help your remember what you did!

Now link the files from the data folder, to perform quality control.

Challenge

Challenge

All the read files start with ERR and have a fastq.gz extension. It means they are in fastq format and compressed. Softlink the files in your molepi/data folder, using a nested loop. The data/fastq folder is three levels up. For each accession number there are two fastq.gz files, one for each end (1 or 2).

Softlinks are done with ln -s. Use the same loop backbone as above, and nest a for loop over the two ends of the reads (1 and 2).

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/data
for sample in <...>
do
  for <loop over 1 2>
  do
    <softlink> ../../../data/fastq/<build the sample with $ and double quotes>.fastq.gz .
  done
done

Bioinformatics workflows


When working with high-throughput sequencing data, the raw reads you get off of the sequencer will need to pass through a number of different tools in order to generate your final desired output. The execution of this set of tools in a specified order is commonly referred to as a workflow or a pipeline.

An example of the workflow we will be using is provided below with a brief description of each step.

Schematic workflow of the bioinformatics workflow
  1. Quality control - Assessing quality using FastQC
  2. Quality control - Trimming and/or filtering reads (if necessary)
  3. Align reads to reference genome - Snippy
  4. Variant calling - Snippy
  5. Clustering variants - iTOL
  6. Assembly - SKESA
  7. Annotation (extra material)
  8. Pangenome analysis (extra material)
  9. Clustering presence and absence of genes (extra material)
  10. Comparison of clustering methods (extra material)
  11. Data visualization - Microreact

These workflows in bioinformatics adopt a plug-and-play approach in that the output of one tool can be easily used as input to another tool without any extensive configuration. Having standards for data formats is what makes this feasible. Standards ensure that data is stored in a way that is generally accepted and agreed upon within the community. The tools that are used to analyze data at different stages of the workflow are therefore built under the assumption that the data will be provided in a specific format.

Quality Control


The first step in the variant calling workflow is to take the FASTQ files received from the sequencing facility and assess the quality of the sequence reads.

Quality control workflow

You’ve already seen that part, but repetition doesn’t hurt. If you feel that it’s anyway unnecessary, move on to the next part.

Details on the FASTQ format

Although it looks complicated (and it is), it’s easy to understand the fastq format with a little decoding. Some rules about the format include…

Line Description
1 Always begins with ‘@’ and then information about the read
2 The actual DNA sequence
3 Always begins with a ‘+’ and sometimes the same info in line 1
4 Has a string of characters which represent the quality scores; must have same number of characters as line 2

We can view the first complete read in one of the files our dataset by using head to look at the first four lines.

Challenge

Challenge

You will use zcat to extract text from a gzipped file.

OUTPUT

@ERR029206.1 IL31_5505:8:1:6233:1087#4/1
TCNAGTCAGCACACACATGCGAAAGAATCCACCGACTAGGGTCAGCGGGGTTTGCAGTTGGTCGCGGACGTAACCG
+
<='=ABBBBCBBBBBBBBC>BBCBBBBBB@BBBBBB=BCBB@@B@@BB@@,@@@@@@@@@@@@@@@@@@@@@@@@@

BASH

zcat -h
head -h

BASH

zcat ERR029206_1.fastq.gz | head -n4 

One of the nucleotides in this read is unknown (N).

Line 4 shows the quality for each nucleotide in the read. Quality is interpreted as the probability of an incorrect base call (e.g. 1 in 10) or, equivalently, the base call accuracy (eg 90%). To make it possible to line up each individual nucleotide with its quality score, the numerical score is converted into a code where each individual character represents the numerical quality score for an individual nucleotide. For example, in the line above, the quality score line is:

OUTPUT

<='=ABBBBCBBBBBBBBC>BBCBBBBBB@BBBBBB=BCBB@@B@@BB@@,@@@@@@@@@@@@@@@@@@@@@@@@@

The < character and each of the = characters represent the encoded quality for an individual nucleotide. The numerical value assigned to each of these characters depends on the sequencing platform that generated the reads. The sequencing machine used to generate our data uses the standard Sanger quality PHRED score encoding, using by Illumina version 1.8 onwards. Each character is assigned a quality score between 0 and 40 as shown in the chart below.

OUTPUT

Quality encoding: !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHI
                  |         |         |         |         |
Quality score:    0........10........20........30........40                                

Each quality score represents the probability that the corresponding nucleotide call is incorrect. This quality score is logarithmically based, so a quality score of 10 reflects a base call accuracy of 90%, but a quality score of 20 reflects a base call accuracy of 99%. These probability values are the results from the base calling algorithm and dependent on how much signal was captured for the base incorporation.

Looking back at our read:

OUTPUT

@ERR029206.1 IL31_5505:8:1:6233:1087#4/1
TCNAGTCAGCACACACATGCGAAAGAATCCACCGACTAGGGTCAGCGGGGTTTGCAGTTGGTCGCGGACGTAACCG
+
<='=ABBBBCBBBBBBBBC>BBCBBBBBB@BBBBBB=BCBB@@B@@BB@@,@@@@@@@@@@@@@@@@@@@@@@@@@

We can now see that the quality of an N (') is 6, which corresponds to a over 25% error probability:

\(10^{-\frac{6}{10}} \cong 0.25\)

Quality Encodings Vary

Although we’ve used a particular quality encoding system to demonstrate interpretation of read quality, different sequencing machines use different encoding systems. This means that, depending on which sequencer you use to generate your data, a # may not be an indicator of a poor quality base call.

Callout

This mainly relates to older Solexa/Illumina data, but it’s essential that you know which sequencing platform was used to generate your data, so that you can tell your quality control program which encoding to use. If you choose the wrong encoding, you run the risk of throwing away good reads or (even worse) not throwing away bad reads!

Assessing Quality using FastQC

In real life, you won’t be assessing the quality of your reads by visually inspecting your FASTQ files. Rather, you’ll be using a software program to assess read quality and filter out poor quality reads. We’ll first use a program called FastQC to visualize the quality of our reads.Later in our workflow, we’ll use another program to filter out poor quality reads.

FastQC has a number of features which can give you a quick impression of any problems your data may have, so you can take these issues into consideration before moving forward with your analyses. Rather than looking at quality scores for each individual read, FastQC looks at quality collectively across all reads within a sample. The image below shows a FastQC-generated plot that indicates a very high quality sample:

A FastQC output showing reads with good quality

The x-axis displays the base position in the read, and the y-axis shows quality scores. In this example, the sample contains reads that are 40 bp long. For each position, there is a box-and-whisker plot showing the distribution of quality scores for all reads at that position. The horizontal red line indicates the median quality score and the yellow box shows the 2nd to 3rd quartile range. This means that 50% of reads have a quality score that falls within the range of the yellow box at that position. The whiskers show the range to the 1st and 4th quartile.

For each position in this sample, the quality values do not drop much lower than 32. This is a high quality score. The plot background is also color-coded to identify good (green), acceptable (yellow), and bad (red) quality scores.

Now let’s take a look at a quality plot on the other end of the spectrum.

A FastQC output showing reads with bad quality

Here, we see positions within the read in which the boxes span a much wider range. Also, quality scores drop quite low into the “bad” range, particularly on the tail end of the reads. The FastQC tool produces several other diagnostic plots to assess sample quality, in addition to the one plotted above.

Running FastQC

Navigate to your FASTQ dataset:

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/data
Challenge

Exercise

We softlinked the samples. How many FASTQ files are in this dataset? Why is this? What is the difference between the two files that start with the same name? Discuss with your neighbour.

There are 14 FASTQ files. Each sample has paired-end reads.

FastQC can accept multiple file names as input, including files that are compressed (.gz) so we can use the *.fastq.gz wildcard to run FastQC on both the compressed FASTQ files for sample ERR029206 in this directory.

BASH

module load FastQC
fastqc ERR029206*.fastq.gz

You will see an automatically updating output message telling you the progress of the analysis. It will start like this:

OUTPUT

Started analysis of ERR029206_1.fastq.gz
Approx 5% complete for ERR029206_1.fastq.gz
Approx 10% complete for ERR029206_1.fastq.gz
Approx 15% complete for ERR029206_1.fastq.gz
Approx 20% complete for ERR029206_1.fastq.gz
Approx 25% complete for ERR029206_1.fastq.gz
Approx 30% complete for ERR029206_1.fastq.gz

In total, it should take a couple minutes minutes for FastQC to run on our two FASTQ files. When the analysis completes, your prompt will return. So your screen will look something like this:

OUTPUT

Approx 85% complete for ERR029206_2.fastq.gz
Approx 90% complete for ERR029206_2.fastq.gz
Approx 95% complete for ERR029206_2.fastq.gz
Analysis complete for ERR029206_2.fastq.gz
data $

The FastQC program has created several new files within our /data/ directory.

BASH

ls

OUTPUT

...
[...]
ERR029206_1.fastq.gz
ERR029206_1_fastqc.html
ERR029206_1_fastqc.zip
ERR029206_2.fastq.gz
ERR029206_2_fastqc.html
ERR029206_2_fastqc.zip
[...]

For each input gzipped FASTQ file, FastQC has created a .zip file and a .html file. The .zip file extension indicates that this is actually a compressed set of multiple output files. We’ll be working with these output files soon. The .html file is a stable webpage displaying the summary report for each of our samples.

We want to keep our data files and our results files separate, so we will move these output files into a new directory within our results/ directory.

BASH

mkdir ../results/fastqc_untrimmed_reads
mv *.zip ../results/fastqc_untrimmed_reads/
mv *.html ../results/fastqc_untrimmed_reads/

Now we can navigate into this results directory and do some closer inspection of our output files.

BASH

cd ../results/fastqc_untrimmed_reads/

Viewing HTML files

If we are working on our local computers, we may display each of these HTML files as a webpage. Otherwise, copy the files to your local computer using scp and use your browser:

BASH

firefox ERR029206_1_fastqc.html

You may need to replace the command firefox with the name of another web navigator if you have one.

Discussion

Exercise

Discuss your results with a neighbor. Do the sample looks good in terms of per base sequence quality?

Discussion

Exercise

What are the read lengths of the different samples?

Cleaning Reads


It’s very common to have some reads within a sample, or some positions (near the beginning or end of reads) across all reads that are low quality and should be discarded. We will use a program called seqtk to filter poor quality reads and trim poor quality bases from our samples.

Seqtk Options

Seqtk is a program written in C and aims to be a Swiss Army Knife for sequencing reads. You don’t need to learn C to use Seqtk, but the fact that it’s a C program helps explain the syntax that is used to run Seqtk. Seqtk takes as input files either FASTQ files or gzipped FASTQ files and outputs FASTQ or FASTA files. The basic command to run Seqtk starts like this:

BASH

module load seqtk
seqtk

That’s just the basic command, however. Seqtk has a variety of options and parameters. We will need to specify what options we want to use for our analysis. Here are some of the options:

option meaning
seq common transformation of FASTA/Q
comp get the nucleotide composition of FASTA/Q
trimfq trim FASTQ using the Phred algorithm

In addition to these options, there are a number if trimming options available:

BASH

seqtk trimfq
step meaning
-q error rate threshold (disabled by -b/-e) [0.05]
-l maximally trim down to INT bp (disabled by -b/-e) [30]
-b trim INT bp from left (non-zero to disable -q/-l) [0]
-e trim INT bp from right (non-zero to disable -q/-l) [0].

We will use only a few of these options in our analysis. It is important to understand the steps you are using to clean your data.

A complete command for trimming with seqtk will look something like this:

BASH

seqtk trimfq -q 0.01 ERR01_1.fastq.gz > ERR01_1_trim.fastq

Trimming

Now we will run seqtk trimfq on our data. To begin, make sure you are still in your data directory:

BASH

pwd

We are going to run seqtk on one sample giving it an error rate threshold of 0.01 which indicates the base call accuracy. We request that, after trimming, the chances that a base is called incorrectly are only 1 in 10000.

BASH

seqtk trimfq -q 0.01 ERR029206_1.fastq.gz > ERR029206_1_trim.fastq

Notice that we needed to redirect the output to a file. If we don’t do that, the trimmed fastq data will be displayed in the console.

Challenge

Exercise

Use seqtk fqchk to compare the untrimmed and trimmed reads of ERR029206_1 in terms of number of sequenced bases, percentage of A,G,C,T and N and average quality. What do you notice? Discuss with your neighbor.

BASH

seqtk fqchk ERR029206_1.fastq.gz | head -n 3

OUTPUT

min_len: 76; max_len: 76; avg_len: 76.00; 36 distinct quality values
POS #bases  %A  %C  %G  %T  %N  avgQ    errQ    %low    %high
ALL 315791552   18.0    32.1    32.2    17.7    0.0 30.6    21.4    5.4 94.6

BASH

seqtk fqchk ERR029206_1_trim.fastq | head -n 3

OUTPUT

min_len: 30; max_len: 76; avg_len: 69.12; 36 distinct quality values
POS #bases  %A  %C  %G  %T  %N  avgQ    errQ    %low    %high
ALL 287211920   18.2    32.0    31.9    17.8    0.0 31.7    28.8    1.3 98.7

We’ve just successfully trimmed one of our FASTQ files! However, there is some bad news. seqtk can only operate on one sample at a time and we have more than one sample. The good news is that we can use a for loop to iterate through our sample files quickly! This will take a few minutes.

Challenge

Challenge

Write a loop which trims all .fastq.gz files and redirect the output into _trim.fastq files.

Create a new variable, built from the input file name (ending in .fastq.gz).

BASH

outfile="${infile}"_trim.fastq

infile is the first variable in our loop and takes the value of each of the FASTQ files in our directory. outfile is the second variable in our loop and is defined by adding _trim.fastq to the end of our input file name. Use {} to wrap the variable so that _trim.fastq will not be interpreted as part of the variable name. In addition, quoting the shell variables is a good practice AND necessary if your variables have spaces in them.

For more, check Bash Pitfalls. There are no spaces before or after the =.

BASH

for <loop over infiles ending with .fastq.gz>
do
  outfile="${infile}"_trim.fastq
  seqtk trimfq <error prob at most 0.01> <infile> > <outfile>
done

Go ahead and run the for loop. It should take a few minutes for seqtk to run for each of our fourteen input files. Once it’s done running, take a look at your directory contents.

BASH

ls ERR029206*

OUTPUT

...
ERR029206_1.fastq.gz_trim.fastq  ERR029206_2.fastq.gz_trim.fastq

We’ve now completed the trimming and filtering steps of our quality control process! Before we move on, let’s move our trimmed FASTQ files to a new subdirectory within our data/ directory.

BASH

mkdir trimmed_fastq
mv *fastq.gz_trim* trimmed_fastq
cd trimmed_fastq
ls ERR029206*

OUTPUT

...
ERR029206_1.fastq.gz_trim.fastq
ERR029206_2.fastq.gz_trim.fastq
Challenge

Challenge

Again, use seqtk fqchk to compare the untrimmed and trimmed reads of both samples. Note the number of bases ‘#bases’ of the trimmed and untrimmed reads. Calculate the theoretical coverage of the genomes before and after trimming, assuming that all our genomes do have the same size as our reference genome (4411532 bases).

Hint: Sum up forward and reverse reads!

BASH

seqtk fqchk ERR029206_1.fastq.gz_trim.fastq | head -n 3

OUTPUT

min_len: 30; max_len: 76; avg_len: 69.12; 36 distinct quality values
POS #bases  %A  %C  %G  %T  %N  avgQ    errQ    %low    %high
ALL 287211920   18.2    32.0    31.9    17.8    0.0 31.7    28.8    1.3 98.7

BASH

seqtk fqchk ERR029206_2.fastq.gz_trim.fastq | head -n 3

OUTPUT

min_len: 30; max_len: 76; avg_len: 63.79; 36 distinct quality values
POS #bases  %A  %C  %G  %T  %N  avgQ    errQ    %low    %high
ALL 265048852   18.1    32.1    32.1    17.7    0.0 31.2    25.7    2.5 97.5

Coverage = #bases (forward + reverse) / genome size In this case:

\(125.18 = \dfrac{(287211920 + 265048852)}{4411532}\)

Key Points
  • wget is a computer program to get data from the internet
  • for loops let you perform the same set of operations on multiple files with a single command
  • Sequencing data is large
  • In bioinformatic workflows the output of one tool is the input of the other.
  • FastQC is used to judge the quality of sequencing reads.
  • Data cleaning is an essential step in a genomics pipeline.
  • We will work towards confirming or disputing transmission in TB cases
  • After this practical training you will have some familiarity with working on the command line

Content from Sequence assembly


Last updated on 2026-04-01 | Edit this page

Sequence assembly means the alignment and merging of reads in order to reconstruct the original sequence. The assembly of a genome from short sequencing reads can take a while. We will therefore run this process for two genomes only.

Overview

Questions

  • How can the information in the sequencing reads be reduced?
  • What are the different methods for assembly?

Objectives

  • Understand differences between assembly methods
  • Assemble the short reads

Exercise 1: Sequence assembly with SKESA


The assembler we will run is SKESA. SKESA generates a final assembly from multiple kmers. A list of kmers is automatically selected by SKESA using the maximum read length of the input data, and each individual kmer contributes to the final assembly. If desired, the lengths of kmers can be specified with the --kmer and --steps flags which will adjust automatic kmer selection.

Because assembly of each genome would take a long time, you will only run one assembly here.

Challenge

Preparation

Start the interactive session, go to the molepi subfolder, create a results/assembly subfolder. Then go to the folder containing the fastq files (data/trimmed_fastq) that you created in the previous tutorial.

You know this by now…

BASH

interactive
cd
mkdir

Project is uppmax2026-1-93, cluster is pelle

BASH

interactive <project> <cluster> <time>
cd /proj/g2020004/nobackup/3MK013/<username>/molepi/
mkdir results/assembly
cd data/trimmed_fastq

Running SKESA in a loop

To run SKESA we will use the skesa command with a number of option that we will explore later on. We can start the loop (again, a short loop with only one sample in this actual case to spare computing resources) with the assemblies with:

BASH

module load SKESA
for sample in ERR029206
do
skesa \
--cores 2 \
--memory 8 \
--fastq "${sample}"_1.fastq.gz_trim.fastq "${sample}"_2.fastq.gz_trim.fastq 1> ../../results/assembly/"${sample}".fasta
done

A non-quoted backslash, \ is used as an escape character in Bash. It preserves the literal value of the next character that follows, with the exception of newline. This means that the back slash starts a new line without starting a new command - we only add it for better readability.

Discussion

The output redirection sign (1>) is different than the ususal >. It specifies that only the standard output (i.e. generally the results) will go to that file, while the standard error (i.e. warning and error messages, or other logging information) are displayed on the console. To save the standard error to a file, use 2>, e.g. 

BASH

# Information, don't run that
skesa <options> 1> results.fasta 2> logfile

The assembly should take about 5 minutes per genome, using 2 cores and 8 GB of memory.

Downloading the missing assemblies

If you haven’t assembled all samples, download the finished contigs to your computer and decompress them. They will decompress in a folder called assembly, so one solution is to rename the assembly folder you already have to something else:

BASH

cd ../../results/
mv assembly partial_assembly
tar xvzf /proj/g2020004/nobackup/3MK013/data/assemblies.tar.gz
ls assembly

OUTPUT

ERR026473.fasta ERR026478.fasta ERR026482.fasta ERR029207.fasta
ERR026474.fasta ERR026481.fasta ERR029206.fasta
Challenge

Challenge: What do the command line parameters of SKESA mean?

Find out a) the version of SKESA you are using and b) what the used command line parameters mean.

BASH

skesa -h

prints the help information in skesa

OUTPUT

skesa -h
..
General options:
-h [ --help ]                 Produce help message
-v [ --version ]              Print version
..
--cores arg (=0)              Number of cores to use (default all) [integer]
--memory arg (=32)            Memory available (GB, only for sorted counter)
..
--fastq arg                   Input fastq file(s) (could be used multiple times for different runs) [string]
..
..

Examine the results of the assembly

You will now explore the files output by SKESA. Find out the number of contigs, and the various assembly statistics.

What do the they mean? What are N50, L50, N80 and L80?

Challenge

Challenge: How many contigs were generated by SKESA?

Find out how many contigs there are in the M. tuberculosis isolates. Use for example the GenomeTools software, available as module with the same name on Uppmax. The main program is called gt. The documentation is comprehensive and can be found on the website or via the command line. We are looking for some subcommand that can give use statistics on sequences.

BASH

module load GenomeTools 

BASH

gt --help

BASH

gt seqstat --help

BASH

module load GenomeTools 
gt seqstat <fastafile>

OUTPUT

# number of contigs:     390
# total contigs length:  4239956
# mean contig size:      10871.68
# contig size first quartile: 989
# median contig size:         5080
# contig size third quartile: 15546
# longest contig:             74938
# shortest contig:            200
# contigs > 500 nt:           323 (82.82 %)
# contigs > 1K nt:            291 (74.62 %)
# contigs > 10K nt:           148 (37.95 %)
# contigs > 100K nt:          0 (0.00 %)
# contigs > 1M nt:            0 (0.00 %)
# N50                25167
# L50                54
# N80                11379
# L80                129
Challenge

Challenge: Compare the results of the different samples

How to compare assemblies? What do N50 and L50 mean?

How could you get N50 stats for all the assemblies?

Write a for loop over accessions, printing the accession name and running gt on each fasta file. Grepping for the information you want. You can grep two different patterns by prefixing each pattern with -e. E.g. grep -e "this" -e "that" greps this or that.

BASH

for accession in <all accessions>
do
  echo <variable name, accessed with ${...}>
  gt seqstat <variable name>.fasta | grep -e <first pattern> -e <second patter>
done

Exercise 2: assembly with SPAdes


To compare how different assemblers perform, you will also use SPAdes. SPAdes is a very versatile and can assemble many different data types, including combining long and short reads.

Challenge

Challenge: Assemble the genomes with SPAdes

You will only perform the assembly on one genome, but use the loop form anyway. You will use the --isolate mode, but the --careful mode would also be interesting. This might take 5-10 minutes per genome.

SPAdes can be loaded with the SPAdes module, and the main command is spades.py. Make a spades_assembly folder in the molepi/results folder and go there. Then run a 1-genome loop as above. SPAdes has arguments -1 and -2 for reads from two ends, the -o to use a specific folder to store the output (use <accession>_spades), -t to use several threads (use 2), and -m to set the maximum memory in Gb (use 8).

BASH

Folders etc:

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
mkdir spades_assembly
cd spades_assembly

Running SPAdes

BASH

module load <module>
for accession in ERR029206
do
  <print the accession with echo>
  spades.py \
    <mode isolate> \
    <flag for read file 1> ../../data/trimmed_fastq/"${accession}"_1.fastq.gz_trim.fastq \
    <flag for read file 2> ../../data/trimmed_fastq/"${accession}"_2.fastq.gz_trim.fastq \
    -o <output folder> \
    <options for 2 threads and 8 Gb memory>
done
Challenge

Challenge: Compare the results of the assembly with SPAdes and SKESA

Using Genome Tools, compare the result of the two assemblies.

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
gt --help

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
gt <sequence statistics?> <spades contigs>
gt <sequence statistics?> <skesa contigs>

Exercise 3: Preliminary annotation


Physical annotation

The goal here is to find ORFs and start codons, and thus identify proteins in the genome.

Challenge

Challenge: Use prodigal

Find how prodigal works and use it to annotate the proteome of ERR029206. Make an annotation folder in the molepi/results folder. Use default settings, only setting the input file -i and writing the protein translations (-a) to a .faa file. Redirect the standard output (>) to a .gbk file. For both files, use the accession number as prefix.

BASH

module load prodigal
prodigal -h

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
mkdir annotation
cd annotation
module load prodigal
prodigal -i <contig file> -a <accession.faa> > <accession.gbk>

Examine the resulting files, both the .faa and the .gbk. Can you make sense of the information there?

Functional annotation

The physical annotation provided by prodigal identifies genes (ORFs and start codons), but it does not give any information about the function of the genes identified. The next step is thus to infer a function for each of the identified genes. This process usually involves aligning the proteins to different databases, e.g. using BLAST and other programs. You will not perform a full functional annotation in this exercise, but you will try to use blastp to find a RpoB (RNA polymerase B) homolog in the genome.

Challenge

Create a BLAST database

With the proteome (.faa file) of sample ERR029206, create a BLAST database, of protein type. Use the makeblastdb function that comes with the BLAST package.

BASH

module load BLAST+
makeblastdb -h

BASH

module load BLAST+
makeblastdb <database type, protein> -in <proteome file> -out <accession>
Challenge

Find rpoB homologs

Now that you made the database, use the RpoB sequence from E. coli that you retrieved in the BLAST exercise to find whether there are one or several RpoB homologs in the proteome you just annotated. Examine the BLAST results: how many homologs to RpoB in that genome?

BASH

ls ../../../blast/
blastp -query <fasta file> -db accession

Just one has E-values at the right level.

Key Points
  • Assembly is a process which aligns and merges fragments from a longer DNA sequence in order to reconstruct the original sequence.
  • k-mers are short fragments of DNA of length k

Content from Protein structure prediction


Last updated on 2026-04-01 | Edit this page

Overview

Questions

  • How can we predict a protein’s 3D structure from its sequence?
  • How do we evaluate the confidence of predicted structures?

Objectives

  • Predict protein and protein complex structure using AlphaFold.
  • Interpret prediction confidence scores.
  • Visualize predicted structures.
  • Compare predicted structures to known structures.

Introduction


In this episode, we are going to explore protein structure prediction. For structure prediction, you are going to use AlphaFold, a deep learning model based tool developed by DeepMind that has revolutionized the field of protein structure prediction. We will (1) predict the structure of a protein, (2) interpret the confidence of the predictions, (3) visualize the predicted structures, and (4) compare them to known structures. Let’s get started by setting up our environment for prediction and loading the necessary libraries.

Task 1: Predicting structure of a protein


We will use the AlphaFold/3.0.1 module from Pelle for protein structure prediction. Let’s start!

Challenge

Challenge 1.1: prepare the terrain

First, using your username and password you need to login to Pelle. The course base folder is at /proj/g2020004/nobackup/3MK013. Go to your own folder, create a protein-structure-exercise subfolder, and move into it.

Remember those commands?

BASH

ssh -Y
cd
mkdir
ls

BASH

ssh -Y <username>@pelle.uppmax.uu.se

Remember to replace <basefolder> and <username> accordingly.

BASH

cd <basefolder>/<username>
mkdir protein-structure-exercise
cd protein-structure-exercise
Challenge

Challenge 1.2: upload the AlphaFold3 parameters file

Probably you already have downloaded the AlphaFold3 models using this link.

First, we need to create a params sub-directory under protein-structure-exercise directory to store the AlphaFold3 parameters file on Pelle. Then we will upload the parameters file from the local machine into that params directory on Pelle.

Use mkdir command to create a new directory, and upload the file into the params directory using scp command.

BASH

# create params directory on Pelle
mkdir <basefolder>/<username>/protein-structure-exercise/params 
# Open a new terminal on your local machine and use the following command to upload the parameters file to Pelle. Remember to replace `<path_to_parameters_file>` and `<username>` accordingly.
scp <path_to_parameters_file> <username>@pelle.uppmax.uu.se:<basefolder>/<username>/protein-structure-exercise/params
Challenge

Challenge 1.3: prepare the input file

AlphaFold takes the amino acid (AA) sequence of a protein as input and predicts its 3D structure. For this task, we will use the AA sequence of Adenylate kinase from Escherichia coli (UniProt ID: P69441). You can download the sequence of Adenylate kinase using the following code:

BASH

wget https://rest.uniprot.org/uniprotkb/P69441.fasta

This will download the FASTA file containing the amino acid sequence of the protein.

Q.1 Can you tell how many amino acids are in the sequence? You can use the grep command to count.

The grep -v ">" command removes the header line, tr -d '\n' removes newlines, and wc -c counts the number of characters, which corresponds to the number of amino acids.

BASH

grep -v ">" P69441.fasta | tr -d '\n' | wc -c
Challenge

Challenge 1.3: prepare the input file (continued)

You can check how AlphaFold3 input files look like here. You can manually format the input file according to the specifications. But for this exercise, we will use a script that automates the process.

First, we create a directory called af3-input:

Use mkdir command to create a new directory.

BASH

mkdir af3-input
Challenge

Challenge 1.3: prepare the input file (continued)

Now use the following command to prepare the input file for AlphaFold3:

BASH

python3 <basefolder>/scripts/fasta_to_af3_json.py -i ./P69441.fasta -n P69441 -o ./af3-input/

This command will take the FASTA file as input and generate a JSON file that can be used as AlphaFold3 input. You can inspect the structure of the JSON file using the cat or less command.

BASH

cat ./af3-input/P69441.json

Q.2 Can you explain why the P69441.json file has its version set to 1 ? Does it follow AlphaFold3 input specification?

Check AlphaFold3 input file preparation instruction here

Check the section about versions in the AlphaFold3 input file preparation instruction.

Challenge

Challenge 1.4: run AlphaFold3 prediction

Now that we have the input file ready, we can run the AlphaFold3 prediction.

First, we create output directory for storing the AF3 predicted results:

BASH

mkdir af3-output

Now, we will load the AlphaFold3 module, which allows us to run an already installed version AlphaFold3. Use the following command:

BASH

module load AlphaFold/3.0.1

You should check whether the module is actually loaded by using the following command:

BASH

module list

We will run AlphaFold3 using slurm. You can check the instructions. For this course, we will use a script that generates a ready-to-use slurm command.

Then, we can run the prediction using the following command:

BASH

python3 <basefolder>/scripts/create_af3_slurm_job.py -p <Project-Code> -i ./af3-input/P69441.json -o ./af3-output -m ./params > job.sh

Now we execute the job as following:

BASH

sbatch job.sh

This command runs the AlphaFold3 prediction using the input JSON file and saves the results in the af3-output directory. You can check the status of your job using the squeue -u <username> command.

Q.3 How long did the prediction take?

You can check the log file generated by the slurm job.

The log file will have a name like slurm-<job_id>.out.

Task 2: Interpret the confidence score of the predictions


Now that we have generated a predicted structure, we will evaluate how reliable it is.

In the output directory (af3-output), you will find several files. One with the suffix _summary_confidences.json, contains the confidence scores for the predicted structure. You can use the following command to view the contents of the confidence summary file:

BASH

cat af3-output/p69441/p69441_summary_confidences.json 

The predicted template modeling (pTM) score and the interface predicted template modeling (ipTM) score are both derived from a measure called the template modeling (TM) score. This measures the accuracy of the entire structure. A pTM score above 0.5 means the overall predicted fold for the complex might be similar to the true structure. ipTM measures the accuracy of the predicted relative positions of the subunits within the complex. Values higher than 0.8 represent confident high-quality predictions, while values below 0.6 suggest likely a failed prediction. ipTM values between 0.6 and 0.8 are a gray zone where predictions could be correct or incorrect. source.

Challenge

Challenge 2.1: checking prediction quality

Q.4 What are the pTM and ipTM scores for the predicted structure of Adenylate kinase? Does it indicate a good prediction?

You can find the pTM and ipTM scores in the _summary_confidences.json file. Look for the keys "pTM" and "ipTM" in the JSON file.

First find the confidence scores using the command below:

BASH

cat af3-output/p69441/p69441_summary_confidences.json 

A pTM score above 0.5 suggests the overall fold is likely correct.
High ipTM values (e.g. >0.8) indicate confident prediction of interactions.
If your scores fall in these ranges, the prediction is likely reliable.

Task 3: Visualize the predicted structures


To visualize the predicted structure, you can use a molecular visualization tool such as PyMOL. In case you can not install these tools on your local machine, you can use the web-based tool RCSB 3D View to visualize the predicted structure. However, for this course we will use PyMOL and here is the installation instruction link.

To visualize the predicted structure using PyMOL, you can follow these steps:

Download the predicted structure file (with suffix _model.cif) from the af3-output directory to your local machine.

You can use the scp command to securely copy the file from the remote server to your local machine. Replace <username> with your actual username and <local_path> with the path where you want to save the file on your local machine.

BASH

scp <username>@pelle.uppmax.uu.se:<basefolder>/<username>/protein-structure-exercise/af3-output/p69441/p69441_model.cif <local_path>

To visualize in PyMOL, first open PyMOL software on your local machine. PyMol has it’s own command line interface, just like the terminal. You can use that terminal and type the following command to load the predicted structure file:

BASH

load <path_to_cif_file>/p69441_model.cif

Task 4: Compare predicted structures to known structures


From UniProt Db entry for Adenylate kinase (P69441), we can see that there are several known structures for this protein in the Protein Data Bank (PDB).

You can find the PDB IDs for the known structures in the UniProt entry under the “Structure” section. For this exercise, we will compare our predicted structure to the known structure with PDB ID 1AKE.

Using PyMol terminal, you can fetch the known structure from the PDB database using the following command:

BASH

fetch 1AKE

You can then align the predicted structure to the known structure using the following command:

BASH

align p69441_model, 1AKE

This will align the predicted structure (P69441_model) to the known structure (1AKE) and provide you with an RMSD (Root Mean Square Deviation) value, which indicates how closely the predicted structure matches the known structure. A lower RMSD value indicates a better match.

You can also superimpose the two structures to visually compare them using the following command:

BASH

super p69441_model, 1AKE

This will superimpose the predicted structure onto the known structure, allowing you to visually assess the similarities and differences between the two structures.

Challenge

Challenge 4.1: checking structural alignment

Q.5 What is the RMSD value between the predicted structure and the known structure? Does it indicate a good prediction?

Align predicted structure with the known structure from PDB database, using PyMOL.

A low RMSD (e.g. <2 Å) indicates strong agreement with the known structure.
Higher values suggest deviations and lower prediction accuracy.

Task 5: Predict structure of a protein complex


In this section, we will predict structure of a protein complex 4fqb, where one protein is a toxic effector Tse1 and the other one is an immune protein Tsi1. They together form a protein complex, soon we will see their complex structure.

Let’s begin with copying the FASTA file from /data/ directory to your <basefolder>/<username>/protein-structure-exercise directory. The file we need to copy is called 4fqb.fasta.

BASH

cp <basefolder>/data/4fqb.fasta <basefolder>/<username>/protein-structure-exercise/ 

Then, we prepare the AlphaFold3 input JSON file using the fasta_to_af3_json.py script. Use the following command:

BASH

python3 <basefolder>/scripts/fasta_to_af3_json.py -i ./4fqb.fasta -n 4fqb -o ./af3-input/

Next, you need to run AlphaFold3 prediction using af3-input/4fqb.json file as input. It is very similar as the steps described in Challenge 1.4. Only exception is when you use create_af3_slurm_job.py script, the input (-i) should be changed as -i af3-input/4fqb.json. See below:

Check whether the AlphaFold3 module is still loaded:

BASH

module list

If not, load AlphaFold3 module:

BASH

module load AlphaFold/3.0.1

Check whether the module is now loaded successfully:

BASH

module list

Then, we create slurm job:

BASH

python3 <basefolder>/scripts/create_af3_slurm_job.py -p <Project-Code> -i ./af3-input/4fqb.json -o ./af3-output -m ./params > job_complex.sh

Now we execute the job as following:

BASH

sbatch job_complex.sh
Challenge

Challenge 2: check the confidence score, visualise and compare the predicted complex with experimentally derived structure

After the prediction is complete, check the confidence score and compare the predicted structure with the known structure from the PDB database (4FQB) using instruction from Task 2, 3 and 4.

Q.6 Based on the confidence score and RMSD value, do you think AlphaFold3 performed well in predicting the protein complex?

If both confidence scores (pTM/ipTM) are high and RMSD is low, AlphaFold3 performed well.
If scores are low or RMSD is high, the prediction may be unreliable.

In this episode, we explored how to predict, evaluate, and validate protein structures using AlphaFold3.

Key Points
  • AlphaFold predicts structure from sequence
  • pTM/ipTM indicate confidence
  • RMSD measures structural similarity

Content from Mapping


Last updated on 2026-04-01 | Edit this page

In this episode we will try to pinpoint single nucleotide polymorphism (SNPs), also called single nucleotide variants (SNVs), between our samples and the reference. The SNPs are determined by a process called read mapping in which reads are aligned to the reference sequence.

Overview

Questions

  • How to generate a phylogenetic tree from SNP data?

Objectives

  • Map reads against a reference genome
  • Extract single nucleotide polymorphisms
  • Establish a phylogenetic tree from the SNP data
Mapping of SNP reads

The identified SNPs will be used to compare the isolates to each other and to establish a phylogenetic tree.

SNP calling


snippy is a pipeline that contains different tools to determine SNPs in sequencing reads against a reference genome. It takes forward and reverse reads of paired-end sequences and aligns them against a reference.

Challenge

Challenge

First we’ll start the interactive session, load the snippy module and create a snps folder in the molepi/results to hold the results from snippy.

BASH

interactive -A uppmax2026-1-93 -M pelle -t 04:00:00
module load snippy
cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
mkdir snps

Snippy is fast but a single run still takes about 15 minutes. We would therefore tell snippy to run all the samples after each other. However this time we cannot use a wildcard to do so. We would instead run all the samples in a loop. The “real” loop is commented out, and we use one that runs only the sample we’ve analyzed so far.

BASH

cd ../data/trimmed_fastq/
#for sample in ERR026473 ERR026474 ERR026478 ERR026481 ERR026482 ERR029206 ERR029207
for sample in ERR029206
do
snippy --ram 8 --outdir ../../results/snps/"${sample}" --ref ../GCF_000195955.2_ASM19595v2_genomic.fna --R1 "${sample}"_1.fastq.gz_trim.fastq --R2 "${sample}"_2.fastq.gz_trim.fastq
done

Here, we provide snippy with an output folder (--outdir), the location of the reference genome (--ref), and the trimmed read files for each end of the pair (--R1 and --R2). We also indicate that snippy should use 8 Gb of memory (--ram 8).

BASH

head -n10 ../../results/snps/ERR029206/snps.tab 

OUTPUT

CHROM	POS	TYPE	REF	ALT	EVIDENCE	FTYPE	STRAND	NT_POS	AA_POS	EFFECT	LOCUS_TAG	GENE	PRODUCT
NC_000962.3	1849	snp	C	A	A:217 C:0
NC_000962.3	1977	snp	A	G	G:118 A:0
NC_000962.3	4013	snp	T	C	C:176 T:0
NC_000962.3	7362	snp	G	C	C:156 G:0
NC_000962.3	7585	snp	G	C	C:143 G:0
NC_000962.3	9304	snp	G	A	A:127 G:0
NC_000962.3	11820	snp	C	G	G:164 C:0
NC_000962.3	11879	snp	A	G	G:125 A:0
NC_000962.3	14785	snp	T	C	C:163 T:1

This list gives us information on every SNP that was found by snippy when compared to the reference genome. The first SNP is found at the position 1849 of the reference genome, and is a C in the H37Rv (reference strain) and an A in isolate ERR029206. There is a high confidence associated with this SNP: an A has been found 217 times in the sequencing reads and never a C at this position.

Now copy a reduced version of the results obtained from the other samples, save it in the results folder. We will also rename the existing snps folder to save it. We extract them from the archive in the data folder, using tar. tar is a program to take multiple files, including their folder structure and put them in a single tar “ball”. Often the tarballs are compressed with gzip.

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
mv snps snps_partial
mkdir snps
cd snps
tar xvzf ../../../../data/snps.tar.gz
ls *

OUTPUT

ERR026473:
ref.fa.          snps.bam.bai  snps.filt.vcf  snps.log	     snps.tab  snps.vcf.gz
ref.fa.fai	     snps.bed      snps.gff       snps.raw.vcf   snps.txt  snps.vcf.gz.csi
snps.aligned.fa  snps.csv      snps.html      snps.subs.vcf  snps.vcf

ERR026474:
ref.fa		       snps.bam.bai  snps.filt.vcf  snps.log	     snps.tab  snps.vcf.gz
ref.fa.fai	     snps.bed      snps.gff       snps.raw.vcf   snps.txt  snps.vcf.gz.csi
snps.aligned.fa  snps.csv      snps.html      snps.subs.vcf  snps.vcf

Note the unusual way to pass arguments to tar with just xvzf instead of -x -v -z -f or -xvzf. x tells tar to extract the archive (c would be used to create the archive); v is for verbose, providing more information on the output; z tells tar to decompress the file; f tells what file to work on.

The folders don’t contain everything that is output by snippy, to save space. But it is enough to run snippy-core, which summarizes several snippy runs.

Challenge

Challenge: How many SNPs were identified in each sample??

Find out how many SNPs were identified in the M. tuberculosis isolates when compared to H37Rv. Hint: The .txt file in the snippy output contains summary information:

From the molepi/results/snps folder:

BASH

cat ERR029207/snps.txt
Challenge

Challenge: How many SNPs were identified in each sample?? (continued)

OUTPUT

DateTime        2023-05-17T13:51:57
ReadFiles       [...]/data/trimmed_fastq/ERR029207_1.fastq.gz_trim.fastq [...]/data/trimmed_fastq/ERR029207_2.fastq.gz_trim.fastq
Reference       [...]/data/GCF_000195955.2_ASM19595v2_genomic.fna
ReferenceSize   4411532
Software        snippy 4.6.0
Variant-COMPLEX 32
Variant-DEL     57
Variant-INS     52
Variant-MNP     2
Variant-SNP     1290
VariantTotal    1433

This M. tuberculosis isolate contains 1290 SNPs compared to H37Rv.

Repeat this for the other isolates. How about using a for loop?

BASH

for accession in ERR*; do
  echo <accession>
  cat <accession/snps.txt | grep <pattern>
done

Core SNPs


In order to compare the identified SNPs with each other we need to know if a certain position exists in all isolates. A core site can have the same nucleotide in every sample (monomorphic) or some samples can be different (polymorphic).

In this second part, after identifying them, snippy will concatenate the core SNPs, i.e. ignoring sites that are monomorphic in all isolates and in the reference. Concatenation of the SNP sites considerably reduces the size of the alignment.

The --ref argument provides the reference genome. Each folder containing the result of the previous step of snippy is then added to the command line.

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results/snps
snippy-core --ref=../../data/GCF_000195955.2_ASM19595v2_genomic.fna ERR026473 ERR026474 ERR026478 ERR026481 ERR026482 ERR029206 ERR029207

Instead of writing all samples explicitly, we could use wildcards:

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results/snps
snippy-core --ref=../../data/GCF_000195955.2_ASM19595v2_genomic.fna ERR*

The last few lines look like this:

OUTPUT

...
Loaded 1 sequences totalling 4411532 bp.
Will mask 0 regions totalling 0 bp ~ 0.00%
0	ERR026473	snp=1378	del=174	ins=165	het=747	unaligned=125683
1	ERR026474	snp=1369	del=180	ins=143	het=811	unaligned=123020
2	ERR026478	snp=1381	del=221	ins=143	het=638	unaligned=112145
3	ERR026481	snp=1349	del=215	ins=138	het=754	unaligned=126217
4	ERR026482	snp=1348	del=215	ins=145	het=911	unaligned=127554
5	ERR029206	snp=1352	del=152	ins=98	het=1839	unaligned=122677
6	ERR029207	snp=1355	del=152	ins=97	het=1900	unaligned=118570
Opening: core.tab
Opening: core.vcf
Processing contig: NC_000962.3
Generating core.full.aln
Creating TSV file: core.txt
Running: snp-sites -c -o core.aln core.full.aln
This analysis is totally hard-core!
Done.

Our output was written to ‘core.aln’. But let’s have a look at the results.

Discussion

Discussion: What’s in the output of snippy??

Have a look at the content of these three files>

core.aln

core.full.aln

core.tab

core.txt

What is the difference between these files? Why is core.aln smaller than core.full.aln? What is in core.aln?

Phylogenetic tree


We will here infer a phylogenetic tree from the file ‘core.aln’ with IQ-TREE.

In this case, we want IQ-TREE to automatically select the best (nucleotide) substitution model. IQ-TREE does that by testing many (among a very large collection) substitution models. We also have SNP data, which by definition do not contain constant (invariable) sites. We thus input the alignment with the -s option and the model with -m MFP+ASC. MFP will tell IQ-TREE to test a range of models, and ASC will correct for the fact that there is no constant sites.

Challenge

Challenge

Infer a phylogenetic tree with IQ-TREE, using the aligned polymorphic sites identified by snippy-core above. IQ-TREE should find the best possible model, adding the correction for no constant sites. Don’t forget to load the right module.

BASH

iqtree -h

BASH

module load <module>
iqtree <alignment> <model testing>

OUTPUT

...
Total wall-clock time used: 0.312 sec (0h:0m:0s)

Analysis results written to:
  IQ-TREE report:                core.aln.iqtree
  Maximum-likelihood tree:       core.aln.treefile
  Likelihood distances:          core.aln.mldist
  Screen log file:               core.aln.log

Date and Time: Thu May 18 09:00:37 2023

With this small data set, IQ-TREE finishes very quickly. Let’s put the resulting files into a separate folder and let’s rename our resulting tree.

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results
mkdir tree
mv snps/core.aln.* tree

Let’s inspect our tree, and give it another extension to make it clear it is a newick file.

BASH

cd tree
mv core.aln.treefile core.aln.newick 
cat core.aln.newick

OUTPUT

(ERR026473:0.0004854701,ERR026474:0.0004356437,((((ERR026478:0.0000010000,ERR029207:0.0000010000):0.0000010000,ERR029206:0.0000131789):0.0006712219,Reference:0.0075887710):0.0000152316,(ERR026481:0.0000066238,ERR026482:0.0000131899):0.0005602421):0.0002373720);

This does not look much like a tree yet. The tree is written in a bracket annotation, the Newick format. In order to make sense of it we can better view this in a tree viewer.

Challenge

Challenge: Can you identify what substitution model IQ-TREE used?

What model was selected? How does IQ-TREE choose between different models? What does e.g. “JC+ASC+G4” means?

The log file of IQ-TREE contains a lot of information.

The IQ-TREE website contains a description of the DNA substitution models.

BASH

cat core.aln.iqtree

OUTPUT

...
Best-fit model according to BIC: TVMe+ASC
...

IQ-TREE chose the TVMe+ASC model. We’ve discussed the ASC above, and you can read more about the TVMe in the IQ-TREE manual. In short, it is a mdoel where base frequencies are deemed equal, and all rates estimated independently, except the rates of transversions (A <-> G and C <-> T) are equal.

The model selection process is also described on the IQ-TREE website.

Challenge

Challenge: Visualize the tree on your computer

Copy the tree in Newick format (core.aln.newick) to your computer using scp and use FigTree or phylo.io to visualize it. Do you see a way to assess the quality of the tree?

BASH

scp <username>@pelle.uppmax.uu.se:<file with path> .
Challenge

Challenge: Rerun the tree, calculating bootstraps this time

In the Phylogenetics module, we calculated 1000 UltraFast bootstraps using the -B 1000 option. Here, calculate 100 non-parametric bootstraps. Non-parametric bootstraps are bootstraps that are calculated without making assumptions about the data. In that case, it means actually resampling the alignment and calculating trees for each of the bootstrapped alignments. It is a much slower process than the UltraFast method (which is parametric), but in that case, since the alignment is very small, the computational load is acceptable.

With IQ-TREE, non-parametric bootstraps are inferred using the -b <n bootstraps> option. Make sure all files are prefixed with core.aln.100npb (option --prefix).

The process will take a minute or so. Then in the results folder, next to the tree folder, create a tree100npb folder and move the results file there.

BASH

cd /proj/g2020004/nobackup/3MK013/<username>/molepi/results/snps
iqtree <alignment> <model as before> <100 non-parametric bootstraps> <prefix>
cd ..
mkdir tree100npb
mv snps/core.aln.100npb* tree100npb/
Discussion

Challenge: Can you identify what substitution model IQ-TREE used? (continued)

When that finishes, copy the resulting tree to your local computer and visualize it. Display support values: - With FigTree: on the left menu, tick “Branch labels”, and choose the last row (what you entered when prompted to do so, label by default) - With phylo.io: when loading the tree, tick the “Use internal label for branches”. Then click on “Settings” > “Branches & Labels”, use the drop menu “A” under “Node labels” and choose “Data”.

Figtree
As shown by FigTree
phylo.io
As shown by phylo.io

As shown by phylo.io, beta version. Note the position of the “99”.

Key Points
  • Single nucleotide polymorphisms can be identified by mapping reads to a reference genome
  • Parameters for the analysis have to be selected based on expected outcomes for this organism
  • Concatenation of SNPs helps to reduce analysis volume
  • Phylogenetic trees can be written with a bracket syntax in Newick format

Content from Molecular epidemiology


Last updated on 2026-04-01 | Edit this page

The low mutation rate of M. tuberculosis means that even at the highest resolution provided by whole genome sequencing it is still difficult to confidently affirm the inferences of transmission made by traditional epidemiological techniques. This means it is very difficult to determine transmission inclusively. However, whole genome sequencing does in some cases allow us to exclude direct transmission, by using the phylogenetic context provided by other strains. Not only does whole genome sequencing provide the inter-cluster differentiation provided by current typing methods, but it also achieves intra-cluster resolution which can be used to inform epidemiological investigation.

Overview

Questions

  • How are phylogenetic trees viewed and compared?
  • How can I visualize several layers of data?
  • In which cases is transmission likely?

Objectives

  • Explore the resulting trees in conjunction with the meta data.
  • Make an estimation on the likelihood of transmission events
  • Compare and interpret the different data sources.

Comparison of clustering results


We grouped (clustered) our isolates by the information that we extracted from the sequencing reads. We compared our isolates to a reference genome and clustered them on basis of the single nucleotide variations that they exhibit when compared to this reference.

workflow

Next, we will visualize this clustering in the context of the meta data. Make sure you have the SNP tree that you generated (or can be downloaded here core.aln.newick) on your own computer. Download also the metadata file.

Visualization of genetic information and metadata


Visualization is frequently used to aid the interpretation of complex datasets. Within microbial genomics, visualizing the relationships between multiple genomes as a tree provides a framework onto which associated data (geographical, temporal, phenotypic and epidemiological) are added to generate hypotheses and to explore the dynamics of the system under investigation.

  1. Open Chrome. Go to microreact.
  2. Click on ‘Upload’. Drag-and-drop the newick tree produced by snippy and IQ-TREE (core.aln.newick).
  3. Click on “Add more files” and select the the metadata file, which is a table comprising metadata file. Choose ‘Data (csv or tsv)’ as file kind.
  4. Click on continue.

First, the tree should be rooted with the reference strain (the one that has the longest branch). Hover over the middle of the long branch, until a circle appears. Right-click on it, and select “Set as root (re-root)”.

Explore the location, time and further meta data. Play around with the different visualization options with the help of the documentation of microreact.

Discussion

Discussion

  1. Which transmission events are likely based on the metadata (location, RFLP, date) alone?
  2. Which transmission events are likely based on the SNP data?
  3. Draw a transmission tree if possible.

Discussion


Compare the pangenome clustering with the clustering based on SNPs and with the data from epidemiological contact tracing:

Cluster A

  • Patient A1 - sample ERR029207
  • Patient A2 - sample ERR029206
  • Patient A3 - sample ERR026478

Cluster B

  • Patient B1 - sample ERR026474
  • Patient B2 - sample ERR026473

Cluster C

  • Patient C1 - sample ERR026481
  • Patient C2 - sample ERR026482

Which transmission events are affirmed by the genomic data? Which ones partially or not? Why?

Key Points
  • SNP phylogeny and metadata can convey different messages
  • Human interpretation is often needed to weigh the different information sources.
  • The low mutation rate of M. tuberculosis does not allow to make confident inferences of transmission but does allow to exclude transmission